Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04473
Gene name
Locationscaffold_04:3340002..3340452
Strand+
Gene length (bp)450
Transcript length (bp)270
Coding sequence length (bp)270
Protein length (aa) 90

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07297 DPM2 Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) 4.2E-31 3 76

GO

GO Term Description Terminal node
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0030234 enzyme regulator activity Yes
GO:0019348 dolichol metabolic process Yes
GO:0044281 small molecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0016093 polyprenol metabolic process No
GO:0008152 metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0016021 integral component of membrane No
GO:0031224 intrinsic component of membrane No
GO:0006066 alcohol metabolic process No
GO:0006720 isoprenoid metabolic process No
GO:0031300 intrinsic component of organelle membrane No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0071704 organic substance metabolic process No
GO:0098772 molecular function regulator activity No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0031301 integral component of organelle membrane No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:1901615 organic hydroxy compound metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 47 69 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04473
MLDKLLGLAMLVAASVVFLYYSVWTLLMPFVDDDHPLQNFFLPRVWAIRIPVIFVLLVSAVVGSFLGTVMIRSNR
KKASKAKAAAKKKA*
Coding >Ophcf2|04473
ATGCTCGACAAACTCCTGGGCCTCGCCATGCTCGTGGCCGCCTCCGTCGTCTTCCTCTACTACTCCGTCTGGACC
CTCCTCATGCCCTTCGTCGACGACGACCACCCCCTTCAAAACTTCTTCCTCCCTCGCGTCTGGGCCATTCGAATC
CCCGTCATCTTCGTCCTCCTCGTCTCCGCCGTCGTCGGCTCCTTTCTCGGCACCGTCATGATTCGGAGCAACCGC
AAGAAGGCCTCCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA
Transcript >Ophcf2|04473
ATGCTCGACAAACTCCTGGGCCTCGCCATGCTCGTGGCCGCCTCCGTCGTCTTCCTCTACTACTCCGTCTGGACC
CTCCTCATGCCCTTCGTCGACGACGACCACCCCCTTCAAAACTTCTTCCTCCCTCGCGTCTGGGCCATTCGAATC
CCCGTCATCTTCGTCCTCCTCGTCTCCGCCGTCGTCGGCTCCTTTCTCGGCACCGTCATGATTCGGAGCAACCGC
AAGAAGGCCTCCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA
Gene >Ophcf2|04473
ATGGTAACCATAACCATCGTTTCATCCCCTCGTTCCCACCAATGCTAACGCCTCGCAGCTCGACAAACTCCTGGG
CCTCGCCATGCTCGTGGCCGCCTCCGTCGTCTTCCTCTACTACTCCGTCTGGACCCTCCTCATGGTCCGTAAAAA
CTCCTGTCTATTTCTCCTCAAGTCCATCTATCCTCAATCTCCCCATTCCTCTGGCGAGCTTACCTCGCGCGCCTC
ACTCCAATTCAAACCTTTACAACTCGCTAATAAGCCCAGCCCTTCGTCGACGACGACCACCCCCTTCAAAACTTC
TTCCTCCCTCGCGTCTGGGCCATTCGAATCCCCGTCATCTTCGTCCTCCTCGTCTCCGCCGTCGTCGGCTCCTTT
CTCGGCACCGTCATGATTCGGAGCAACCGCAAGAAGGCCTCCAAAGCCAAGGCCGCCGCCAAGAAGAAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail