Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04472
Gene name
Locationscaffold_04:3337621..3339571
Strand-
Gene length (bp)1950
Transcript length (bp)1950
Coding sequence length (bp)1950
Protein length (aa) 650

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02847 MA3 MA3 domain 2.9E-23 383 488
PF02854 MIF4G MIF4G domain 1.0E-10 91 273

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5566 0.6389 0.1414 0.0422 0.1095 0.0304 0.0486 0.0267 0.0348 0.004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1267
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3845
Ophiocordyceps australis map64 (Brazil) OphauB2|5687
Ophiocordyceps camponoti-floridani Ophcf2|04472 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7042
Ophiocordyceps kimflemingae Ophio5|2319
Ophiocordyceps subramaniannii Hirsu2|1052

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04472
MASARAEMPRRDRGGDSYRPTRPRRPRSRSPAPKPTEEEKQAAAKQEYQRLLNVRSGGTYMPPARLRALQAQITD
KTSKEYQRMAWEALKKSINGLINKVNTANIKHIVPELFGENLVRGRGLFCRSVMKAQAASLPFTAVYAAMVAVVN
TKLPQVGELLVQRLVVQFRKAFRRNDKGVCLSATSFLAHLVNQQVLHEMLAGQILLLLLHKPTDDSVEIAVGFCR
EVGQYVEEMQPAMAVAVFDQFRNILHEAGIDKRTQYMVEVLFQVRKDKFRDNPAVKEELDLVEEEDQITHQVSLE
GDIDVQDGLNVFKFDAEWEENEEAYRKLRGEILGESGEESEEGAEEEEEEDDDDDDDDEEDEEDEETKALEIKDQ
SNADLVNLRRTIYLTIMSSADPEEAVHKLIKINLPAGQEAELPSMIIECCSQEKTYTKFFGLIGERFAKINRLWC
DLFEQAFSKYYDTIHRYENNKLRNMAMLFGHMLAQDAIGWHCLSAIHLNEEETTSSSRIFIKILFQSVSEEMGLS
KLKGRVEDEALRESLTGLFPVEGVRNLRFAINYFTSIGLGALTDGLRERLDAAPKPSLPALVVGGGWGWGWGFGF
EFSSYTGSSYSRSRSRSGSRDGGEVEVEGWREEMEVEVEVEVEVEIEIE*
Coding >Ophcf2|04472
ATGGCTTCGGCGCGAGCGGAAATGCCGCGTCGCGACCGTGGAGGCGACTCTTACCGCCCGACTCGGCCTCGACGA
CCTCGTTCCCGCTCGCCAGCTCCAAAGCCGACAGAGGAAGAGAAGCAAGCGGCGGCCAAGCAAGAATATCAGCGT
CTCCTCAACGTGCGCTCCGGCGGAACCTACATGCCCCCCGCTCGCCTGCGGGCGCTACAGGCTCAGATCACGGAC
AAGACGAGCAAGGAATATCAGCGGATGGCGTGGGAGGCGCTCAAGAAGAGCATCAACGGGCTGATCAACAAGGTC
AACACTGCAAACATCAAGCACATCGTCCCCGAACTGTTCGGCGAGAACTTGGTGAGGGGGAGGGGGTTGTTCTGC
CGGTCTGTCATGAAGGCTCAGGCGGCGAGCTTGCCCTTCACGGCGGTCTACGCGGCCATGGTCGCGGTTGTGAAT
ACAAAGTTGCCGCAGGTGGGCGAGTTGCTTGTTCAGAGGCTGGTGGTGCAGTTTCGGAAGGCGTTTAGGAGGAAC
GACAAGGGGGTTTGCTTGTCGGCGACGTCGTTTCTCGCCCATCTCGTTAACCAGCAGGTCCTTCACGAGATGTTG
GCCGGGCAGATACTCTTGCTGCTGCTTCACAAGCCGACGGATGATAGCGTGGAGATTGCTGTCGGGTTCTGTCGA
GAGGTTGGTCAGTACGTGGAGGAGATGCAGCCTGCCATGGCCGTCGCCGTCTTCGACCAGTTCAGGAACATTCTA
CACGAGGCCGGCATCGACAAGCGCACGCAGTACATGGTCGAGGTGCTCTTCCAGGTTCGCAAGGATAAGTTCCGC
GACAATCCCGCCGTCAAGGAGGAGCTGGACCTCGTGGAGGAGGAGGATCAGATCACGCATCAGGTCAGCCTCGAA
GGCGATATCGATGTGCAGGATGGGCTCAACGTTTTCAAGTTTGATGCCGAGTGGGAGGAGAATGAGGAGGCGTAT
AGGAAGCTTCGCGGAGAGATTTTGGGAGAGAGTGGAGAGGAGAGTGAGGAAGGGGCAGAAGAAGAAGAAGAAGAA
GATGATGATGATGATGATGATGACGAGGAGGACGAGGAAGATGAGGAGACCAAGGCCTTGGAGATCAAGGATCAG
TCCAACGCGGACCTCGTCAACCTTCGACGAACAATCTACCTGACCATCATGTCCAGCGCCGACCCGGAGGAAGCA
GTCCACAAACTCATCAAGATCAACCTGCCCGCCGGTCAAGAGGCAGAGCTGCCGTCGATGATAATCGAATGCTGC
TCACAGGAAAAGACGTACACGAAATTCTTCGGCCTCATCGGCGAGCGCTTCGCAAAGATCAATCGACTTTGGTGC
GACCTCTTCGAACAAGCCTTTTCAAAATACTACGACACCATCCACCGATACGAGAACAACAAGCTGAGGAACATG
GCCATGCTATTCGGTCACATGCTCGCCCAGGACGCCATCGGCTGGCATTGCCTCTCAGCGATCCATCTGAACGAA
GAGGAAACGACGTCGAGCAGCCGCATCTTCATCAAGATTCTCTTCCAGAGCGTCTCCGAGGAGATGGGCCTTTCG
AAGCTCAAGGGCAGGGTCGAGGACGAGGCGCTGAGGGAGAGTCTGACGGGCTTGTTCCCCGTCGAGGGGGTGAGG
AACTTGAGGTTCGCCATCAATTACTTTACGAGCATCGGCTTGGGGGCTTTGACGGATGGCTTGAGGGAGAGGCTC
GATGCGGCGCCTAAACCGAGTCTTCCTGCTTTGGTGGTTGGGGGGGGATGGGGATGGGGATGGGGATTCGGTTTC
GAGTTTTCGAGTTATACGGGGTCTTCTTACTCACGATCTAGGTCGAGGTCGGGGTCGAGGGATGGGGGGGAGGTC
GAGGTCGAGGGATGGAGGGAGGAGATGGAGGTCGAGGTCGAGGTCGAGGTCGAGGTCGAGATCGAGATCGAGTGA
Transcript >Ophcf2|04472
ATGGCTTCGGCGCGAGCGGAAATGCCGCGTCGCGACCGTGGAGGCGACTCTTACCGCCCGACTCGGCCTCGACGA
CCTCGTTCCCGCTCGCCAGCTCCAAAGCCGACAGAGGAAGAGAAGCAAGCGGCGGCCAAGCAAGAATATCAGCGT
CTCCTCAACGTGCGCTCCGGCGGAACCTACATGCCCCCCGCTCGCCTGCGGGCGCTACAGGCTCAGATCACGGAC
AAGACGAGCAAGGAATATCAGCGGATGGCGTGGGAGGCGCTCAAGAAGAGCATCAACGGGCTGATCAACAAGGTC
AACACTGCAAACATCAAGCACATCGTCCCCGAACTGTTCGGCGAGAACTTGGTGAGGGGGAGGGGGTTGTTCTGC
CGGTCTGTCATGAAGGCTCAGGCGGCGAGCTTGCCCTTCACGGCGGTCTACGCGGCCATGGTCGCGGTTGTGAAT
ACAAAGTTGCCGCAGGTGGGCGAGTTGCTTGTTCAGAGGCTGGTGGTGCAGTTTCGGAAGGCGTTTAGGAGGAAC
GACAAGGGGGTTTGCTTGTCGGCGACGTCGTTTCTCGCCCATCTCGTTAACCAGCAGGTCCTTCACGAGATGTTG
GCCGGGCAGATACTCTTGCTGCTGCTTCACAAGCCGACGGATGATAGCGTGGAGATTGCTGTCGGGTTCTGTCGA
GAGGTTGGTCAGTACGTGGAGGAGATGCAGCCTGCCATGGCCGTCGCCGTCTTCGACCAGTTCAGGAACATTCTA
CACGAGGCCGGCATCGACAAGCGCACGCAGTACATGGTCGAGGTGCTCTTCCAGGTTCGCAAGGATAAGTTCCGC
GACAATCCCGCCGTCAAGGAGGAGCTGGACCTCGTGGAGGAGGAGGATCAGATCACGCATCAGGTCAGCCTCGAA
GGCGATATCGATGTGCAGGATGGGCTCAACGTTTTCAAGTTTGATGCCGAGTGGGAGGAGAATGAGGAGGCGTAT
AGGAAGCTTCGCGGAGAGATTTTGGGAGAGAGTGGAGAGGAGAGTGAGGAAGGGGCAGAAGAAGAAGAAGAAGAA
GATGATGATGATGATGATGATGACGAGGAGGACGAGGAAGATGAGGAGACCAAGGCCTTGGAGATCAAGGATCAG
TCCAACGCGGACCTCGTCAACCTTCGACGAACAATCTACCTGACCATCATGTCCAGCGCCGACCCGGAGGAAGCA
GTCCACAAACTCATCAAGATCAACCTGCCCGCCGGTCAAGAGGCAGAGCTGCCGTCGATGATAATCGAATGCTGC
TCACAGGAAAAGACGTACACGAAATTCTTCGGCCTCATCGGCGAGCGCTTCGCAAAGATCAATCGACTTTGGTGC
GACCTCTTCGAACAAGCCTTTTCAAAATACTACGACACCATCCACCGATACGAGAACAACAAGCTGAGGAACATG
GCCATGCTATTCGGTCACATGCTCGCCCAGGACGCCATCGGCTGGCATTGCCTCTCAGCGATCCATCTGAACGAA
GAGGAAACGACGTCGAGCAGCCGCATCTTCATCAAGATTCTCTTCCAGAGCGTCTCCGAGGAGATGGGCCTTTCG
AAGCTCAAGGGCAGGGTCGAGGACGAGGCGCTGAGGGAGAGTCTGACGGGCTTGTTCCCCGTCGAGGGGGTGAGG
AACTTGAGGTTCGCCATCAATTACTTTACGAGCATCGGCTTGGGGGCTTTGACGGATGGCTTGAGGGAGAGGCTC
GATGCGGCGCCTAAACCGAGTCTTCCTGCTTTGGTGGTTGGGGGGGGATGGGGATGGGGATGGGGATTCGGTTTC
GAGTTTTCGAGTTATACGGGGTCTTCTTACTCACGATCTAGGTCGAGGTCGGGGTCGAGGGATGGGGGGGAGGTC
GAGGTCGAGGGATGGAGGGAGGAGATGGAGGTCGAGGTCGAGGTCGAGGTCGAGGTCGAGATCGAGATCGAGTGA
Gene >Ophcf2|04472
ATGGCTTCGGCGCGAGCGGAAATGCCGCGTCGCGACCGTGGAGGCGACTCTTACCGCCCGACTCGGCCTCGACGA
CCTCGTTCCCGCTCGCCAGCTCCAAAGCCGACAGAGGAAGAGAAGCAAGCGGCGGCCAAGCAAGAATATCAGCGT
CTCCTCAACGTGCGCTCCGGCGGAACCTACATGCCCCCCGCTCGCCTGCGGGCGCTACAGGCTCAGATCACGGAC
AAGACGAGCAAGGAATATCAGCGGATGGCGTGGGAGGCGCTCAAGAAGAGCATCAACGGGCTGATCAACAAGGTC
AACACTGCAAACATCAAGCACATCGTCCCCGAACTGTTCGGCGAGAACTTGGTGAGGGGGAGGGGGTTGTTCTGC
CGGTCTGTCATGAAGGCTCAGGCGGCGAGCTTGCCCTTCACGGCGGTCTACGCGGCCATGGTCGCGGTTGTGAAT
ACAAAGTTGCCGCAGGTGGGCGAGTTGCTTGTTCAGAGGCTGGTGGTGCAGTTTCGGAAGGCGTTTAGGAGGAAC
GACAAGGGGGTTTGCTTGTCGGCGACGTCGTTTCTCGCCCATCTCGTTAACCAGCAGGTCCTTCACGAGATGTTG
GCCGGGCAGATACTCTTGCTGCTGCTTCACAAGCCGACGGATGATAGCGTGGAGATTGCTGTCGGGTTCTGTCGA
GAGGTTGGTCAGTACGTGGAGGAGATGCAGCCTGCCATGGCCGTCGCCGTCTTCGACCAGTTCAGGAACATTCTA
CACGAGGCCGGCATCGACAAGCGCACGCAGTACATGGTCGAGGTGCTCTTCCAGGTTCGCAAGGATAAGTTCCGC
GACAATCCCGCCGTCAAGGAGGAGCTGGACCTCGTGGAGGAGGAGGATCAGATCACGCATCAGGTCAGCCTCGAA
GGCGATATCGATGTGCAGGATGGGCTCAACGTTTTCAAGTTTGATGCCGAGTGGGAGGAGAATGAGGAGGCGTAT
AGGAAGCTTCGCGGAGAGATTTTGGGAGAGAGTGGAGAGGAGAGTGAGGAAGGGGCAGAAGAAGAAGAAGAAGAA
GATGATGATGATGATGATGATGACGAGGAGGACGAGGAAGATGAGGAGACCAAGGCCTTGGAGATCAAGGATCAG
TCCAACGCGGACCTCGTCAACCTTCGACGAACAATCTACCTGACCATCATGTCCAGCGCCGACCCGGAGGAAGCA
GTCCACAAACTCATCAAGATCAACCTGCCCGCCGGTCAAGAGGCAGAGCTGCCGTCGATGATAATCGAATGCTGC
TCACAGGAAAAGACGTACACGAAATTCTTCGGCCTCATCGGCGAGCGCTTCGCAAAGATCAATCGACTTTGGTGC
GACCTCTTCGAACAAGCCTTTTCAAAATACTACGACACCATCCACCGATACGAGAACAACAAGCTGAGGAACATG
GCCATGCTATTCGGTCACATGCTCGCCCAGGACGCCATCGGCTGGCATTGCCTCTCAGCGATCCATCTGAACGAA
GAGGAAACGACGTCGAGCAGCCGCATCTTCATCAAGATTCTCTTCCAGAGCGTCTCCGAGGAGATGGGCCTTTCG
AAGCTCAAGGGCAGGGTCGAGGACGAGGCGCTGAGGGAGAGTCTGACGGGCTTGTTCCCCGTCGAGGGGGTGAGG
AACTTGAGGTTCGCCATCAATTACTTTACGAGCATCGGCTTGGGGGCTTTGACGGATGGCTTGAGGGAGAGGCTC
GATGCGGCGCCTAAACCGAGTCTTCCTGCTTTGGTGGTTGGGGGGGGATGGGGATGGGGATGGGGATTCGGTTTC
GAGTTTTCGAGTTATACGGGGTCTTCTTACTCACGATCTAGGTCGAGGTCGGGGTCGAGGGATGGGGGGGAGGTC
GAGGTCGAGGGATGGAGGGAGGAGATGGAGGTCGAGGTCGAGGTCGAGGTCGAGGTCGAGATCGAGATCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail