Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04467
Gene name
Locationscaffold_04:3323482..3325957
Strand-
Gene length (bp)2475
Transcript length (bp)2154
Coding sequence length (bp)2154
Protein length (aa) 718

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08785 Ku_PK_bind Ku C terminal domain like 6.6E-35 595 714
PF02735 Ku Ku70/Ku80 beta-barrel domain 6.4E-24 284 446
PF03731 Ku_N Ku70/Ku80 N-terminal alpha/beta domain 4.3E-10 6 149

GO

GO Term Description Terminal node
GO:0006303 double-strand break repair via nonhomologous end joining Yes
GO:0003677 DNA binding Yes
GO:0006302 double-strand break repair No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0005488 binding No
GO:0051716 cellular response to stimulus No
GO:0044260 cellular macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0050896 response to stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0033554 cellular response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006950 response to stress No
GO:0006281 DNA repair No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.462 0.8521 0.165 0.0442 0.0716 0.0121 0.0298 0.0729 0.0579 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3486
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1916
Ophiocordyceps australis map64 (Brazil) OphauB2|5696
Ophiocordyceps camponoti-floridani Ophcf2|04467 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4472
Ophiocordyceps kimflemingae Ophio5|4940
Ophiocordyceps subramaniannii Hirsu2|6655

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04467
MAEKEATVFILDLGASMARANAGRDESDLDWCMRYVWDKITDIVAANRKTLCVGVVGLRTDETKNKLQADDGYEN
ISVLQGLGQMTMSSLRTLRESIQPSNTCSGDAISAIVVAVDMIDGFTKRLKWLRKIVLVTDGKGDMDADDTADIS
KKMNDLGIQLTILGVDFDDPEYGFKEEDKPPTKAANESTLRKLADACQDGIFATMAEAIGELQVPRVKSIKPYKT
YDGPLTLGDPATLPCAMNINVERFFGTHLARPLGASTVVVNSEPVATQSTRTLRAESPEGADFAAVKQARAYKVN
DPEAPGGKRDVEFQSLARGYEYGRTAVHISESEHNITQLESKKSFSIVGFIPWNKYEPFLSMGEMCATHARNGDA
KSELAMSSLVWALMELESYAIARIVVKDGKEPLLVLLAPHIEPDIECLYDVPLPFAEDVRSYQFPPLDKVITVSG
QTLTKHRLLPTNELNEAMSDYVDAMDLSTYGAEGGMGSAEYAPIDETFNPSIHRINHAVRMRAVHPDKPVPPTPP
VLLQYCAPPEDLIERVQSRIKALIEVAGVKKVPPKAKGRRPRESIKPISGLDIDALLGETKEKGQVSRENAIPDF
KRALAAAASASEMDEVAKQMGSIVRGLVTDSFGDSRYEQAMECMGVMRDELVSAEEPGIYNSFVRDLKKALLSGA
LGGDRRDYWYMLRTSRLGLISKDQSEASAVSPEQAEEFYSSR*
Coding >Ophcf2|04467
ATGGCGGAAAAAGAAGCGACCGTCTTCATCCTGGATCTCGGCGCCTCCATGGCCCGGGCCAACGCAGGCCGTGAC
GAGTCCGACCTCGACTGGTGCATGCGCTATGTCTGGGATAAGATCACCGACATCGTGGCCGCAAATCGGAAGACG
CTGTGTGTTGGCGTCGTGGGACTGCGGACTGATGAGACAAAAAACAAGCTCCAGGCGGATGACGGTTACGAAAAC
ATATCCGTCTTGCAGGGCCTGGGGCAGATGACCATGTCCAGCCTCAGAACCCTACGAGAATCCATCCAGCCGAGT
AACACCTGCTCCGGAGATGCCATATCAGCCATAGTCGTCGCCGTCGACATGATCGATGGCTTTACCAAAAGACTG
AAGTGGCTCCGCAAAATCGTTCTCGTCACCGATGGGAAAGGAGATATGGACGCCGACGACACGGCCGACATCTCC
AAGAAGATGAACGACTTGGGCATTCAACTGACCATTCTTGGCGTGGACTTTGACGATCCAGAATACGGTTTCAAA
GAAGAGGACAAGCCGCCTACAAAGGCCGCGAATGAGTCGACGCTGAGGAAGCTGGCCGATGCCTGTCAGGACGGC
ATCTTTGCTACCATGGCCGAGGCCATCGGCGAACTCCAGGTTCCCAGGGTCAAGTCCATCAAGCCATACAAGACG
TACGACGGACCGCTCACTCTGGGAGATCCCGCAACGCTGCCCTGCGCCATGAACATCAACGTTGAGAGATTCTTC
GGGACGCACCTTGCTCGCCCCTTGGGTGCCTCTACAGTCGTCGTCAACTCGGAGCCGGTGGCGACGCAATCAACT
CGCACGCTTCGAGCAGAGTCCCCCGAGGGTGCCGATTTTGCTGCCGTGAAACAAGCTCGGGCCTACAAGGTCAAC
GATCCCGAGGCCCCTGGCGGAAAGCGTGACGTCGAGTTCCAGTCTCTGGCCAGAGGCTACGAATACGGACGGACA
GCGGTGCATATCAGCGAATCCGAACACAATATCACCCAGCTCGAGTCCAAAAAGTCATTCTCCATCGTCGGCTTC
ATTCCGTGGAACAAGTACGAACCCTTTCTCAGCATGGGCGAAATGTGTGCAACTCACGCAAGAAATGGCGATGCC
AAATCGGAGCTGGCCATGTCGTCGCTCGTCTGGGCCCTCATGGAGCTTGAATCGTACGCCATTGCTCGCATCGTC
GTCAAGGACGGTAAGGAACCCTTACTGGTTCTGCTGGCTCCGCACATCGAGCCCGACATCGAGTGCCTCTATGAC
GTGCCTCTCCCGTTCGCAGAGGACGTTCGCAGCTACCAGTTCCCGCCCCTCGACAAGGTCATTACGGTCAGCGGG
CAGACGCTCACCAAGCATCGTCTGCTGCCGACGAATGAGCTCAACGAGGCCATGAGCGACTACGTTGACGCCATG
GATCTCTCTACGTACGGCGCGGAGGGAGGCATGGGGTCGGCCGAGTATGCTCCTATTGACGAGACTTTCAACCCG
TCCATTCATCGCATCAACCACGCGGTGAGGATGCGTGCGGTTCATCCGGACAAGCCAGTTCCCCCGACTCCTCCG
GTGCTGCTACAGTATTGTGCTCCGCCAGAGGACTTGATAGAGCGAGTACAGAGCAGGATCAAAGCCTTGATTGAA
GTAGCCGGAGTTAAGAAAGTGCCGCCAAAAGCCAAGGGAAGGCGGCCCAGAGAAAGCATCAAGCCCATCTCGGGC
CTCGACATCGATGCGCTGCTGGGCGAGACAAAGGAAAAGGGACAAGTGTCTCGAGAAAATGCGATTCCCGACTTC
AAGCGGGCCCTGGCCGCAGCTGCGTCAGCCAGCGAGATGGATGAGGTCGCAAAGCAGATGGGATCGATTGTGCGA
GGCCTCGTAACGGACAGCTTTGGCGACAGCAGATATGAGCAGGCCATGGAGTGCATGGGGGTAATGCGGGACGAG
CTGGTGAGCGCAGAGGAGCCCGGCATCTACAACTCGTTCGTTCGCGACTTGAAGAAGGCGCTGCTCTCGGGAGCT
CTGGGCGGAGACAGGAGGGACTACTGGTACATGCTGCGGACGTCGAGGCTGGGCCTGATCAGCAAGGACCAGTCT
GAGGCATCGGCCGTCTCGCCCGAGCAGGCGGAGGAGTTTTACAGCTCACGGTGA
Transcript >Ophcf2|04467
ATGGCGGAAAAAGAAGCGACCGTCTTCATCCTGGATCTCGGCGCCTCCATGGCCCGGGCCAACGCAGGCCGTGAC
GAGTCCGACCTCGACTGGTGCATGCGCTATGTCTGGGATAAGATCACCGACATCGTGGCCGCAAATCGGAAGACG
CTGTGTGTTGGCGTCGTGGGACTGCGGACTGATGAGACAAAAAACAAGCTCCAGGCGGATGACGGTTACGAAAAC
ATATCCGTCTTGCAGGGCCTGGGGCAGATGACCATGTCCAGCCTCAGAACCCTACGAGAATCCATCCAGCCGAGT
AACACCTGCTCCGGAGATGCCATATCAGCCATAGTCGTCGCCGTCGACATGATCGATGGCTTTACCAAAAGACTG
AAGTGGCTCCGCAAAATCGTTCTCGTCACCGATGGGAAAGGAGATATGGACGCCGACGACACGGCCGACATCTCC
AAGAAGATGAACGACTTGGGCATTCAACTGACCATTCTTGGCGTGGACTTTGACGATCCAGAATACGGTTTCAAA
GAAGAGGACAAGCCGCCTACAAAGGCCGCGAATGAGTCGACGCTGAGGAAGCTGGCCGATGCCTGTCAGGACGGC
ATCTTTGCTACCATGGCCGAGGCCATCGGCGAACTCCAGGTTCCCAGGGTCAAGTCCATCAAGCCATACAAGACG
TACGACGGACCGCTCACTCTGGGAGATCCCGCAACGCTGCCCTGCGCCATGAACATCAACGTTGAGAGATTCTTC
GGGACGCACCTTGCTCGCCCCTTGGGTGCCTCTACAGTCGTCGTCAACTCGGAGCCGGTGGCGACGCAATCAACT
CGCACGCTTCGAGCAGAGTCCCCCGAGGGTGCCGATTTTGCTGCCGTGAAACAAGCTCGGGCCTACAAGGTCAAC
GATCCCGAGGCCCCTGGCGGAAAGCGTGACGTCGAGTTCCAGTCTCTGGCCAGAGGCTACGAATACGGACGGACA
GCGGTGCATATCAGCGAATCCGAACACAATATCACCCAGCTCGAGTCCAAAAAGTCATTCTCCATCGTCGGCTTC
ATTCCGTGGAACAAGTACGAACCCTTTCTCAGCATGGGCGAAATGTGTGCAACTCACGCAAGAAATGGCGATGCC
AAATCGGAGCTGGCCATGTCGTCGCTCGTCTGGGCCCTCATGGAGCTTGAATCGTACGCCATTGCTCGCATCGTC
GTCAAGGACGGTAAGGAACCCTTACTGGTTCTGCTGGCTCCGCACATCGAGCCCGACATCGAGTGCCTCTATGAC
GTGCCTCTCCCGTTCGCAGAGGACGTTCGCAGCTACCAGTTCCCGCCCCTCGACAAGGTCATTACGGTCAGCGGG
CAGACGCTCACCAAGCATCGTCTGCTGCCGACGAATGAGCTCAACGAGGCCATGAGCGACTACGTTGACGCCATG
GATCTCTCTACGTACGGCGCGGAGGGAGGCATGGGGTCGGCCGAGTATGCTCCTATTGACGAGACTTTCAACCCG
TCCATTCATCGCATCAACCACGCGGTGAGGATGCGTGCGGTTCATCCGGACAAGCCAGTTCCCCCGACTCCTCCG
GTGCTGCTACAGTATTGTGCTCCGCCAGAGGACTTGATAGAGCGAGTACAGAGCAGGATCAAAGCCTTGATTGAA
GTAGCCGGAGTTAAGAAAGTGCCGCCAAAAGCCAAGGGAAGGCGGCCCAGAGAAAGCATCAAGCCCATCTCGGGC
CTCGACATCGATGCGCTGCTGGGCGAGACAAAGGAAAAGGGACAAGTGTCTCGAGAAAATGCGATTCCCGACTTC
AAGCGGGCCCTGGCCGCAGCTGCGTCAGCCAGCGAGATGGATGAGGTCGCAAAGCAGATGGGATCGATTGTGCGA
GGCCTCGTAACGGACAGCTTTGGCGACAGCAGATATGAGCAGGCCATGGAGTGCATGGGGGTAATGCGGGACGAG
CTGGTGAGCGCAGAGGAGCCCGGCATCTACAACTCGTTCGTTCGCGACTTGAAGAAGGCGCTGCTCTCGGGAGCT
CTGGGCGGAGACAGGAGGGACTACTGGTACATGCTGCGGACGTCGAGGCTGGGCCTGATCAGCAAGGACCAGTCT
GAGGCATCGGCCGTCTCGCCCGAGCAGGCGGAGGAGTTTTACAGCTCACGGTGA
Gene >Ophcf2|04467
ATGGCGGAAAAAGAAGCGACCGTCTTCATCCTGGATCTCGGCGCCTCCATGGCCCGGGCCAACGCAGGCCGTGAC
GAGTCCGACCTCGACTGGTGCATGCGCTATGTCTGGGATAAGATCACCGACATCGTGGCCGCAAATCGGAAGACG
CTGTGTGTTGGCGTCGTGGGACTGCGGACTGATGAGACAAAAAACAAGCTCCAGGCGGATGACGGTTACGAAAAC
ATATCCGTCTTGCAGGGCCTGGGGCAGATGACCATGTCCAGCCTCAGAACCCTACGAGAATCCATCCAGCCGAGT
AACACCTGCTCCGGAGATGCCATATCAGCCATAGTCGTCGCCGTCGACATGATCGATGGCTTTACCAAAAGACTG
AAGTGGCTCCGCAAAATCGTTCTCGTCACCGATGGGAAAGGAGATATGGACGCCGACGACACGGCCGACATCTCC
AAGAAGATGAACGACTTGGGCATTCAACTGACCATTCTGTACGTTCTGAGACCCCGCAGTGTTGGATCTTCGTAT
GGACTGACGGCAAAGAAAGTGGCGTGGACTTTGACGATCCAGAATACGGTTTCAAAGAAGAGGACAAGCCGCCTA
CAAAGGTATGGCGGACTGTTACGAACCCACGGCGTGAATAATAATCAGAAAAATTGTAGGCCGCGAATGAGTCGA
CGCTGAGGAAGCTGGCCGATGCCTGTCAGGACGGCATCTTTGCTACCATGGCCGAGGCCATCGGCGAACTCCAGG
TTCCCAGGGTCAAGTCCATCAAGCCATACAAGACGTACGACGGACCGCTCACTCTGGGAGATCCCGCAACGCTGC
CCTGCGCCATGAACATCAACGTTGAGAGATTCTTCGGGACGCACCTTGCTCGCCCCTTGGGTGCCTCTACAGTCG
TCGTCAACTCGGAGCCGGTGGCGACGCAATCAACTCGCACGCTTCGAGCAGAGTCCCCCGAGGGTGCCGATTTTG
CTGCCGTGAAACAAGCTCGGGCCTACAAGGTCAACGATCCCGAGGCCCCTGGCGGAAAGCGTGACGTCGAGTTCC
AGTCTCTGGCCAGAGGCTACGAATACGGACGGACAGCGGTGCATATCAGCGAATCCGAACACAATATCACCCAGC
TCGAGTCCAAAAAGTCATTCTCCATCGTCGGCTTCATTCCGTGGAACAAGGTCGGAACCTCTCACTGCCTCAAAG
GGATAATGCTGACGATCAACTTAAAGTACGAACCCTTTCTCAGCATGGGCGAAATGTGTGCAACTCACGCAAGAA
ATGGCGATGCCAAATCGGAGCTGGCCATGTCGTCGCTCGTCTGGGCCCTCATGGAGCTTGAATCGTACGCCATTG
CTCGCATCGTCGTCAAGGACGGTAAGGAACCCTTACTGGTTCTGCTGGCTCCGCACATCGAGCCCGACATCGAGT
GCCTCTATGACGTGCCTCTCCCGTTCGCAGAGGACGTTCGCAGCTACCAGTTCCCGCCCCTCGACAAGGTCATTA
CGGTCAGCGGGCAGACGCTCACCAAGCATCGTCTGCTGCCGACGAATGAGCTCAACGAGGCCATGAGCGACTACG
TTGACGCCATGGATCTCTCTACGTACGGCGCGGAGGGAGGCATGTACGTTGCACCACACTTTTACCTCGAAGTCG
ATGCAGTTTACGCTAACTTCGTCAGGGGGTCGGCCGAGTATGCTCCTATTGACGAGACTTTCAACCCGTCCATTC
ATCGCATCAACCACGCGGTGAGGATGCGTGCGGTTCATCCGGACAAGCCAGTTCCCCCGACTCCTCCGGTGCTGC
TACAGTATTGTGCTCCGCCAGAGGACTTGATAGAGCGAGTACAGAGCAGGATCAAAGCCTTGATTGAAGTAGCCG
GAGTTAAGAAAGGCGAGTGTAACGACATCCTACATATATGTGATATAGCGTGCTAACCTTTTATCAGTGCCGCCA
AAAGCCAAGGGAAGGCGGCCCAGAGAAAGCATCAAGCCCATCTCGGGCCTCGACATCGATGCGCTGCTGGGCGAG
ACAAAGGAAAAGGGACAAGTGTCTCGAGAAAATGCGATTCCCGACTTCAAGCGGGCCCTGGCCGCAGCTGCGTCA
GCCAGCGAGATGGATGAGGTCGCAAAGCAGATGGGATCGATTGTGCGAGGCCTCGTAACGGACAGCTTTGGCGAC
AGCAGATATGAGCAGGCCATGGAGTGCATGGGGGTAATGCGGGACGAGCTGGTGAGCGCAGAGGAGCCCGGCATC
TACAACTCGTTCGTTCGCGACTTGAAGAAGGCGCTGCTCTCGGGAGCTCTGGGCGGAGACAGGAGGGACTACTGG
TACATGCTGCGGACGTCGAGGCTGGGCCTGATCAGCAAGGACCAGTCTGAGGCATCGGCCGTCTCGCCCGAGCAG
GCGGAGGAGGTGAGCCGTCAAGCCGGTTGGTGTCATCAGCAGCTAACGTTGGAGCAGTTTTACAGCTCACGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail