Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04465
Gene name
Locationscaffold_04:3320873..3321965
Strand-
Gene length (bp)1092
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 7.0E-30 25 128
PF13242 Hydrolase_like HAD-hyrolase-like 1.9E-13 226 301

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7822 0.447 0.0267 0.1996 0.2655 0.0416 0.175 0.119 0.1415 0.0622

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5500
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1918
Ophiocordyceps australis map64 (Brazil) OphauB2|5698
Ophiocordyceps camponoti-floridani Ophcf2|04465 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4473
Ophiocordyceps kimflemingae Ophio5|4938
Ophiocordyceps subramaniannii Hirsu2|6657

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04465
MAASPKCLTGDRNAIDSFINSFDTFLFDCDGVLWSGDEVFDGVPETLALLRSRGKRTVFVTNNSTKSRQQYAQKL
DSLGIPCDADDVFGSSYSAAVYISRILKLPLGKNKVFVIGEAGVEAELAAEGVPFIGGSDEAFQRDVTPADFGGI
ADGSLLDADVGVVLCGLDFHINYLKLAHALHYLRRGALFLATNLDSTLPMHHDLFLGAGSVLAPLENATGQRPLP
LGKPSQAMMDAIEGKFRLDRSKTCMIGDRLDTDIKFGIDGKLGGTLHVQTGVNKKEDWQKTDAVAVPSFYADKLS
DLLLAK*
Coding >Ophcf2|04465
ATGGCTGCCTCGCCAAAGTGCCTCACTGGGGACAGAAACGCCATCGACAGCTTCATCAACAGCTTCGACACGTTC
CTTTTCGACTGCGATGGCGTGCTATGGTCGGGAGACGAGGTCTTCGATGGCGTGCCGGAAACGCTGGCGCTGCTT
CGCTCTAGAGGCAAGCGTACCGTCTTCGTGACGAATAATTCGACAAAGTCGCGGCAGCAGTATGCTCAGAAACTC
GATAGCCTCGGTATCCCCTGCGACGCCGACGACGTCTTCGGCTCCTCGTACTCGGCCGCCGTCTATATTTCTCGC
ATACTCAAGCTGCCTCTGGGGAAGAACAAGGTGTTTGTCATCGGCGAGGCTGGCGTCGAGGCTGAGCTCGCTGCA
GAGGGTGTCCCTTTTATAGGAGGCTCTGACGAGGCGTTTCAACGTGACGTGACGCCCGCTGACTTTGGCGGCATT
GCTGATGGATCGTTGCTTGATGCGGACGTCGGTGTCGTCTTATGTGGTCTCGACTTTCACATCAACTATCTCAAG
CTCGCCCACGCACTGCATTACCTCCGCCGCGGCGCCCTATTCCTCGCCACGAATCTGGATTCAACCCTTCCCATG
CACCACGATCTCTTCCTCGGCGCCGGCTCCGTTTTGGCACCCCTCGAAAACGCTACGGGTCAGAGACCGCTTCCG
CTGGGCAAGCCGAGCCAGGCCATGATGGATGCCATCGAGGGCAAGTTTCGCCTCGACCGGTCTAAAACGTGCATG
ATTGGCGATCGGCTCGACACGGATATCAAATTCGGCATCGACGGCAAGCTCGGTGGTACTCTTCATGTGCAGACG
GGGGTGAATAAGAAGGAGGATTGGCAGAAGACTGACGCCGTTGCTGTCCCGTCCTTTTATGCTGACAAGTTGAGC
GACCTGCTGCTAGCTAAGTGA
Transcript >Ophcf2|04465
ATGGCTGCCTCGCCAAAGTGCCTCACTGGGGACAGAAACGCCATCGACAGCTTCATCAACAGCTTCGACACGTTC
CTTTTCGACTGCGATGGCGTGCTATGGTCGGGAGACGAGGTCTTCGATGGCGTGCCGGAAACGCTGGCGCTGCTT
CGCTCTAGAGGCAAGCGTACCGTCTTCGTGACGAATAATTCGACAAAGTCGCGGCAGCAGTATGCTCAGAAACTC
GATAGCCTCGGTATCCCCTGCGACGCCGACGACGTCTTCGGCTCCTCGTACTCGGCCGCCGTCTATATTTCTCGC
ATACTCAAGCTGCCTCTGGGGAAGAACAAGGTGTTTGTCATCGGCGAGGCTGGCGTCGAGGCTGAGCTCGCTGCA
GAGGGTGTCCCTTTTATAGGAGGCTCTGACGAGGCGTTTCAACGTGACGTGACGCCCGCTGACTTTGGCGGCATT
GCTGATGGATCGTTGCTTGATGCGGACGTCGGTGTCGTCTTATGTGGTCTCGACTTTCACATCAACTATCTCAAG
CTCGCCCACGCACTGCATTACCTCCGCCGCGGCGCCCTATTCCTCGCCACGAATCTGGATTCAACCCTTCCCATG
CACCACGATCTCTTCCTCGGCGCCGGCTCCGTTTTGGCACCCCTCGAAAACGCTACGGGTCAGAGACCGCTTCCG
CTGGGCAAGCCGAGCCAGGCCATGATGGATGCCATCGAGGGCAAGTTTCGCCTCGACCGGTCTAAAACGTGCATG
ATTGGCGATCGGCTCGACACGGATATCAAATTCGGCATCGACGGCAAGCTCGGTGGTACTCTTCATGTGCAGACG
GGGGTGAATAAGAAGGAGGATTGGCAGAAGACTGACGCCGTTGCTGTCCCGTCCTTTTATGCTGACAAGTTGAGC
GACCTGCTGCTAGCTAAGTGA
Gene >Ophcf2|04465
ATGGCTGCCTCGCCAAAGTGCCTCACTGGGGACAGAAACGCCATCGACAGCTTCATCAACAGCTTCGACGTCAGT
GAACCCCGCCTCCTCCTGCTTTCGCGCGCGCTCACCGAACCCTCAGACGTTCCTTTTCGACTGCGATGGCGAGTT
CGAAAATGTCCGCTGAACGGCTGGACGCGACTGACGCGGCGCAGGCGTGCTATGGTCGGGAGACGAGGTCTTCGA
TGGCGTGCCGGAAACGCTGGCGCTGCTTCGCTCTAGAGGTTCAAGCCCTACCTAACAACCACCCTCTACGCCTCG
AATCTTCGCTTACCTGGCTAATGATGATAAGGCAAGCGTACCGTCTTCGTGACGAATAATTCGACAAAGTCGCGG
CAGCAGTATGCTCAGAAACTCGATAGCCTCGGTATCCCCTGCGACGCCGACGACGTCTTCGGCTCCTCGTACTCG
GCCGCCGTCTATATTTCTCGCATACTCAAGCTGCCTCTGGGGAAGAACAAGGTGTTTGTCATCGGCGAGGCTGGC
GTCGAGGCTGAGCTCGCTGCAGAGGGTGTCCCTTTTATAGGAGGCTCTGACGAGGCGTTTCAACGTGACGTGACG
CCCGCTGACTTTGGCGGCATTGCTGATGGATCGTTGCTTGATGCGGACGTCGGTGTCGTCTTATGTGGTCTCGAC
TTTCACATCAACTATCTCAAGCTCGCCCACGCACTGCATTACCTCCGCCGCGGCGCCCTATTCCTCGCCACGAAT
CTGGATTCAACCCTTCCCATGCACCACGATCTCTTCCTCGGCGCCGGCTCCGTTTTGGCACCCCTCGAAAACGCT
ACGGGTCAGAGACCGCTTCCGCTGGGCAAGCCGAGCCAGGCCATGATGGATGCCATCGAGGGCAAGTTTCGCCTC
GACCGGTCTAAAACGTGCATGATTGGCGATCGGCTCGACACGGATATCAAATTCGGCATCGACGGCAAGCTCGGT
GGTACTCTTCATGTGCAGACGGGGGTGAATAAGAAGGAGGATTGGCAGAAGACTGACGCCGTTGCTGTCCCGTCC
TTTTATGCTGACAAGTTGAGCGACCTGCTGCTAGCTAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail