Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04463
Gene name
Locationscaffold_04:3314354..3318942
Strand-
Gene length (bp)4588
Transcript length (bp)3264
Coding sequence length (bp)3264
Protein length (aa) 1088

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01131 Topoisom_bac DNA topoisomerase 2.0E-97 165 524
PF10330 Stb3 Putative Sin3 binding protein 4.8E-37 836 921
PF01751 Toprim Toprim domain 2.9E-15 3 149

GO

GO Term Description Terminal node
GO:0003916 DNA topoisomerase activity Yes
GO:0006265 DNA topological change Yes
GO:0003677 DNA binding Yes
GO:0006996 organelle organization No
GO:0140097 catalytic activity, acting on DNA No
GO:0043170 macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071840 cellular component organization or biogenesis No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003824 catalytic activity No
GO:0071103 DNA conformation change No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0051276 chromosome organization No
GO:0016043 cellular component organization No
GO:0008150 biological_process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016853 isomerase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5571 0.7198 0.1255 0.0645 0.2712 0.0583 0.0594 0.0626 0.083 0.0192

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3488
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1921
Ophiocordyceps australis map64 (Brazil) OphauB2|5701
Ophiocordyceps camponoti-floridani Ophcf2|04463 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4475
Ophiocordyceps kimflemingae Ophio5|4936
Ophiocordyceps subramaniannii Hirsu2|6659

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04463
MRVLCVAEKPSISKAVAGHMSGGRLQTHGTRNRFVKNYSFDFDFAQAWGQCEVTMTCVSGHLTSVDFPGEYRNWS
HPPPETLFSAPIVTNIHDDSKTIAKNIQDQARYSRLLVIWTDCDLEGEHIGQEIVDAARQGNAAIQVKRARFSNV
ERAHVLSAARRLADLDEKKVNAVRARIELDLRIGCAFTRFLCNSLRSLGGPMEKLTLSYGSCQFPTLGFVVDRYF
RVKNFVPEPFWSIKLTHTKEGKTAVFTWARNRLFDRTTTVILYERCLAAKKAVVTRVQEKPTREFKPLPLTTVEL
QKAATRLLRMNSQRAMVIAEGLYNKGFISYPRTETDRFDKGINLRALVQKQTPSQAWGNFAQGLVDGAFQQPRAG
RNDDKAHPPIHPIAYAAPTVLSAEEAPLYEYVVRRFLACCADDAKGMATDIDVEYGDEHFHARGVIVLERNYLDV
FIYERWDNTAELPRLSRGEQFEPTEAMMTQGKTSPPNYLTEADLIALMDANGIGTDATMADHIQKIQDREYVAVI
DRARSGAGGDDDENGDGPGAREEAPAGRGRGSGRGRRGGRGGAASTGRRGGQKVFVPTQLGVALILGFDRMNFET
SLGKPFLRKEMELKMKAICEGNTTRDMVLRESISQYRHVFFQSQEKLGVLRQACRDITARYQAVTDRQRVARQRR
VCGQHAAFCTRRSDPHAVTSPLDRYGSPGQLGSEPAEMGRATACRTVPDTTEGRRSADGLIPRRSHNKMASAARD
IPKAASMTRDSLTAVAERGEPATVAPTSRALPTPPNSISPALPAHGLKAQLRRARLEPIDSDLDLADADAGIRPP
STAMYEASGAITSAMLAKYHLPEILINHGPLAIRHIVGYLTTSVPGFSGIPPNKARRLVVAALDGRRDADDAEGT
VEFEKVGWGRWNARRRGSVDPRATSSSAPSGAAIPISRVSTRSQHRARAEASRSMGDDSINFSPHHLDDTHMMGT
DADRMSMDGSASASCSEAPDDEVAINDDPDDVTDDEDWAAMGAAALRAESYPSMAAARCDGDFKFATRLRQFAST
GSGMARPPAHFALSALVDASDAQEREAVEALLRLGSV*
Coding >Ophcf2|04463
ATGAGGGTTCTGTGCGTGGCCGAGAAGCCGTCCATCTCCAAGGCTGTTGCCGGTCACATGTCCGGCGGAAGACTT
CAGACGCATGGCACGCGCAATCGCTTCGTCAAGAATTACTCTTTCGACTTTGATTTTGCGCAGGCTTGGGGACAG
TGTGAGGTGACGATGACTTGCGTCTCTGGCCATCTTACAAGTGTCGACTTTCCGGGTGAATATCGCAATTGGAGT
CACCCCCCCCCGGAGACGCTCTTTTCCGCACCCATCGTCACCAATATTCACGATGACAGCAAGACCATCGCCAAG
AATATCCAGGATCAGGCGAGATATTCGCGGCTGTTGGTGATATGGACAGACTGCGATCTCGAAGGAGAGCACATT
GGTCAGGAAATCGTCGACGCTGCTCGTCAAGGAAATGCCGCTATCCAAGTTAAGCGTGCTAGGTTCAGCAACGTG
GAACGAGCTCATGTCCTCTCGGCCGCTAGGCGACTCGCCGACCTCGACGAGAAAAAGGTCAATGCCGTCAGGGCT
AGGATCGAGTTGGATCTGCGAATCGGCTGTGCCTTTACCAGGTTCCTCTGCAACAGTCTCCGGTCGTTGGGCGGG
CCCATGGAGAAGCTCACGCTGAGCTACGGATCGTGCCAGTTTCCTACGCTTGGCTTCGTGGTCGATCGATATTTT
CGCGTCAAGAACTTTGTGCCCGAGCCCTTTTGGAGCATCAAGCTCACGCATACCAAGGAGGGAAAGACGGCCGTC
TTCACTTGGGCGAGGAACCGTCTCTTCGATCGCACCACGACCGTCATCCTCTACGAGCGATGTCTTGCCGCTAAA
AAGGCGGTGGTGACGAGGGTTCAGGAGAAGCCGACGCGCGAGTTTAAGCCATTGCCGCTCACGACGGTCGAGTTG
CAAAAGGCGGCGACCCGTCTGCTCCGCATGAACAGCCAGCGTGCCATGGTCATCGCCGAAGGGCTGTATAACAAG
GGCTTCATTAGCTATCCTCGTACCGAGACGGACCGCTTCGACAAGGGCATCAATCTCAGGGCCCTGGTGCAGAAA
CAGACGCCAAGTCAAGCATGGGGCAACTTTGCTCAGGGCCTGGTCGACGGTGCTTTTCAGCAGCCTCGGGCGGGC
AGAAACGATGACAAGGCGCATCCTCCGATTCATCCCATTGCCTACGCGGCACCGACGGTGCTCAGCGCCGAGGAG
GCGCCCTTGTACGAGTACGTCGTTCGTCGCTTTCTTGCCTGCTGCGCAGATGACGCCAAAGGCATGGCGACGGAT
ATAGACGTCGAGTACGGGGACGAGCACTTTCATGCCCGTGGCGTCATCGTTTTGGAGAGGAATTATCTTGATGTC
TTTATATACGAGAGGTGGGATAACACGGCTGAGCTCCCAAGACTATCAAGGGGTGAGCAGTTTGAACCGACGGAA
GCCATGATGACGCAAGGCAAGACGTCGCCGCCGAATTACCTGACGGAGGCGGACTTGATCGCGCTGATGGACGCC
AACGGTATCGGGACCGACGCCACAATGGCCGATCACATACAAAAGATTCAGGATCGGGAATACGTGGCCGTCATT
GACAGGGCCAGAAGCGGCGCGGGAGGCGATGATGACGAGAACGGAGACGGCCCGGGGGCCAGGGAGGAGGCTCCC
GCCGGTCGCGGACGAGGAAGCGGGCGGGGCCGGCGAGGCGGAAGGGGAGGCGCGGCATCGACCGGGAGGAGAGGC
GGCCAAAAGGTCTTTGTGCCGACTCAACTCGGGGTGGCACTGATCCTGGGTTTCGACCGCATGAACTTTGAGACG
AGTCTGGGGAAGCCGTTCCTACGCAAAGAGATGGAGCTCAAGATGAAGGCCATCTGCGAGGGCAACACGACCAGG
GACATGGTGCTGCGGGAGAGCATCTCTCAGTACCGGCATGTCTTTTTCCAGTCGCAAGAGAAGCTCGGGGTGCTT
CGTCAGGCTTGTCGCGACATTACGGCCCGATACCAGGCGGTGACGGACAGACAGCGAGTCGCGCGGCAGAGACGA
GTCTGCGGCCAGCACGCGGCTTTCTGCACGAGGCGGTCGGATCCGCACGCAGTGACGAGCCCCCTTGACCGATAC
GGAAGCCCAGGTCAGCTCGGGTCCGAGCCGGCCGAGATGGGGCGGGCGACGGCGTGCAGGACGGTTCCTGATACG
ACCGAGGGAAGACGGTCAGCGGACGGGCTCATACCTCGTCGCTCTCACAACAAGATGGCATCGGCTGCTCGCGAT
ATCCCAAAGGCCGCCTCGATGACCCGAGACAGCTTGACTGCTGTAGCGGAACGAGGCGAGCCGGCGACTGTGGCT
CCAACTTCTCGTGCCCTCCCTACACCCCCAAACTCCATCTCCCCCGCCCTGCCGGCCCACGGTCTCAAGGCTCAG
CTCCGGAGGGCCAGGCTCGAACCCATCGACTCGGACCTCGACCTGGCCGACGCCGACGCCGGCATACGGCCCCCT
TCAACGGCCATGTACGAGGCCTCGGGCGCCATCACTAGCGCCATGCTCGCCAAATACCACCTGCCCGAGATACTC
ATCAATCATGGTCCTCTGGCCATCCGACACATCGTCGGATACCTGACCACGTCCGTGCCGGGCTTCTCCGGAATC
CCCCCCAATAAAGCCCGACGTCTCGTCGTCGCCGCTCTCGACGGCCGCCGGGACGCCGACGATGCCGAGGGGACC
GTCGAATTCGAAAAGGTGGGCTGGGGGCGGTGGAATGCTCGTCGGCGAGGCTCCGTCGATCCTCGGGCCACTTCG
TCATCGGCCCCGAGCGGCGCCGCCATTCCCATCTCCCGCGTCAGCACCCGGAGTCAGCACAGGGCCAGGGCCGAG
GCCTCTAGGTCGATGGGGGATGACTCCATCAACTTCTCGCCCCACCACCTCGACGACACGCATATGATGGGCACG
GACGCCGACAGGATGTCCATGGACGGCTCGGCCTCGGCCTCATGCTCCGAGGCCCCCGACGACGAGGTGGCCATC
AACGACGACCCGGATGACGTGACTGACGACGAGGACTGGGCGGCCATGGGCGCGGCCGCCCTCCGGGCCGAGTCG
TATCCCAGCATGGCGGCCGCCCGATGTGACGGCGACTTCAAATTCGCCACCAGGCTGCGACAGTTCGCATCGACG
GGCTCGGGCATGGCGCGTCCGCCCGCGCATTTCGCCTTGTCTGCCCTAGTGGACGCGTCCGATGCCCAGGAGCGT
GAGGCCGTCGAGGCCCTCCTCCGGCTCGGTTCTGTATAA
Transcript >Ophcf2|04463
ATGAGGGTTCTGTGCGTGGCCGAGAAGCCGTCCATCTCCAAGGCTGTTGCCGGTCACATGTCCGGCGGAAGACTT
CAGACGCATGGCACGCGCAATCGCTTCGTCAAGAATTACTCTTTCGACTTTGATTTTGCGCAGGCTTGGGGACAG
TGTGAGGTGACGATGACTTGCGTCTCTGGCCATCTTACAAGTGTCGACTTTCCGGGTGAATATCGCAATTGGAGT
CACCCCCCCCCGGAGACGCTCTTTTCCGCACCCATCGTCACCAATATTCACGATGACAGCAAGACCATCGCCAAG
AATATCCAGGATCAGGCGAGATATTCGCGGCTGTTGGTGATATGGACAGACTGCGATCTCGAAGGAGAGCACATT
GGTCAGGAAATCGTCGACGCTGCTCGTCAAGGAAATGCCGCTATCCAAGTTAAGCGTGCTAGGTTCAGCAACGTG
GAACGAGCTCATGTCCTCTCGGCCGCTAGGCGACTCGCCGACCTCGACGAGAAAAAGGTCAATGCCGTCAGGGCT
AGGATCGAGTTGGATCTGCGAATCGGCTGTGCCTTTACCAGGTTCCTCTGCAACAGTCTCCGGTCGTTGGGCGGG
CCCATGGAGAAGCTCACGCTGAGCTACGGATCGTGCCAGTTTCCTACGCTTGGCTTCGTGGTCGATCGATATTTT
CGCGTCAAGAACTTTGTGCCCGAGCCCTTTTGGAGCATCAAGCTCACGCATACCAAGGAGGGAAAGACGGCCGTC
TTCACTTGGGCGAGGAACCGTCTCTTCGATCGCACCACGACCGTCATCCTCTACGAGCGATGTCTTGCCGCTAAA
AAGGCGGTGGTGACGAGGGTTCAGGAGAAGCCGACGCGCGAGTTTAAGCCATTGCCGCTCACGACGGTCGAGTTG
CAAAAGGCGGCGACCCGTCTGCTCCGCATGAACAGCCAGCGTGCCATGGTCATCGCCGAAGGGCTGTATAACAAG
GGCTTCATTAGCTATCCTCGTACCGAGACGGACCGCTTCGACAAGGGCATCAATCTCAGGGCCCTGGTGCAGAAA
CAGACGCCAAGTCAAGCATGGGGCAACTTTGCTCAGGGCCTGGTCGACGGTGCTTTTCAGCAGCCTCGGGCGGGC
AGAAACGATGACAAGGCGCATCCTCCGATTCATCCCATTGCCTACGCGGCACCGACGGTGCTCAGCGCCGAGGAG
GCGCCCTTGTACGAGTACGTCGTTCGTCGCTTTCTTGCCTGCTGCGCAGATGACGCCAAAGGCATGGCGACGGAT
ATAGACGTCGAGTACGGGGACGAGCACTTTCATGCCCGTGGCGTCATCGTTTTGGAGAGGAATTATCTTGATGTC
TTTATATACGAGAGGTGGGATAACACGGCTGAGCTCCCAAGACTATCAAGGGGTGAGCAGTTTGAACCGACGGAA
GCCATGATGACGCAAGGCAAGACGTCGCCGCCGAATTACCTGACGGAGGCGGACTTGATCGCGCTGATGGACGCC
AACGGTATCGGGACCGACGCCACAATGGCCGATCACATACAAAAGATTCAGGATCGGGAATACGTGGCCGTCATT
GACAGGGCCAGAAGCGGCGCGGGAGGCGATGATGACGAGAACGGAGACGGCCCGGGGGCCAGGGAGGAGGCTCCC
GCCGGTCGCGGACGAGGAAGCGGGCGGGGCCGGCGAGGCGGAAGGGGAGGCGCGGCATCGACCGGGAGGAGAGGC
GGCCAAAAGGTCTTTGTGCCGACTCAACTCGGGGTGGCACTGATCCTGGGTTTCGACCGCATGAACTTTGAGACG
AGTCTGGGGAAGCCGTTCCTACGCAAAGAGATGGAGCTCAAGATGAAGGCCATCTGCGAGGGCAACACGACCAGG
GACATGGTGCTGCGGGAGAGCATCTCTCAGTACCGGCATGTCTTTTTCCAGTCGCAAGAGAAGCTCGGGGTGCTT
CGTCAGGCTTGTCGCGACATTACGGCCCGATACCAGGCGGTGACGGACAGACAGCGAGTCGCGCGGCAGAGACGA
GTCTGCGGCCAGCACGCGGCTTTCTGCACGAGGCGGTCGGATCCGCACGCAGTGACGAGCCCCCTTGACCGATAC
GGAAGCCCAGGTCAGCTCGGGTCCGAGCCGGCCGAGATGGGGCGGGCGACGGCGTGCAGGACGGTTCCTGATACG
ACCGAGGGAAGACGGTCAGCGGACGGGCTCATACCTCGTCGCTCTCACAACAAGATGGCATCGGCTGCTCGCGAT
ATCCCAAAGGCCGCCTCGATGACCCGAGACAGCTTGACTGCTGTAGCGGAACGAGGCGAGCCGGCGACTGTGGCT
CCAACTTCTCGTGCCCTCCCTACACCCCCAAACTCCATCTCCCCCGCCCTGCCGGCCCACGGTCTCAAGGCTCAG
CTCCGGAGGGCCAGGCTCGAACCCATCGACTCGGACCTCGACCTGGCCGACGCCGACGCCGGCATACGGCCCCCT
TCAACGGCCATGTACGAGGCCTCGGGCGCCATCACTAGCGCCATGCTCGCCAAATACCACCTGCCCGAGATACTC
ATCAATCATGGTCCTCTGGCCATCCGACACATCGTCGGATACCTGACCACGTCCGTGCCGGGCTTCTCCGGAATC
CCCCCCAATAAAGCCCGACGTCTCGTCGTCGCCGCTCTCGACGGCCGCCGGGACGCCGACGATGCCGAGGGGACC
GTCGAATTCGAAAAGGTGGGCTGGGGGCGGTGGAATGCTCGTCGGCGAGGCTCCGTCGATCCTCGGGCCACTTCG
TCATCGGCCCCGAGCGGCGCCGCCATTCCCATCTCCCGCGTCAGCACCCGGAGTCAGCACAGGGCCAGGGCCGAG
GCCTCTAGGTCGATGGGGGATGACTCCATCAACTTCTCGCCCCACCACCTCGACGACACGCATATGATGGGCACG
GACGCCGACAGGATGTCCATGGACGGCTCGGCCTCGGCCTCATGCTCCGAGGCCCCCGACGACGAGGTGGCCATC
AACGACGACCCGGATGACGTGACTGACGACGAGGACTGGGCGGCCATGGGCGCGGCCGCCCTCCGGGCCGAGTCG
TATCCCAGCATGGCGGCCGCCCGATGTGACGGCGACTTCAAATTCGCCACCAGGCTGCGACAGTTCGCATCGACG
GGCTCGGGCATGGCGCGTCCGCCCGCGCATTTCGCCTTGTCTGCCCTAGTGGACGCGTCCGATGCCCAGGAGCGT
GAGGCCGTCGAGGCCCTCCTCCGGCTCGGTTCTGTATAA
Gene >Ophcf2|04463
ATGAGGGTTCTGTGCGTGGCCGAGAAGCCGTCCATCTCCAAGGCTGTTGCCGGTCACATGTCCGGCGGAAGACTT
CAGACGGTATGTGGAGAGCTGTGTTTTTTTTTCTTCTTGTTCTTCTGTTAATTATGGGAACAGCATGGCACGCGC
AATCGCTTCGTCAAGAATTACTCTTTCGACTTTGATTTTGCGCAGGCTTGGGGACAGTGTGAGGTGACGATGACT
TGCGTCTCTGGCCATCTTACAAGTGTCGACTTTCCGGGTGAATATCGCAATTGGAGTCACCCCCCCCCGGAGACG
CTCTTTTCCGCACCCATCGTCACCAATATTCACGATGTGAGTCTTTGGTGCGTCAGACGAGCTCCTTTGACACCT
TCTGAGTCCACTTCACAGGACAGCAAGACCATCGCCAAGAATATCCAGGATCAGGCGAGATATTCGCGGCTGTTG
GTGATATGGACAGACTGCGATCTCGAAGGAGAGCACATTGGTCAGGAAATCGTCGACGCTGCTCGTCAAGGAAAT
GCCGCTATCCAAGTTAAGCGTGCTAGGTTCAGCAACGTGGAACGAGCGTATGTCGACAGAAGCCTCATGTCGTCT
GCCGTCTCAACTGACTCTTCAGTCATGTCCTCTCGGCCGCTAGGCGACTCGCCGACCTCGACGAGAAAAAGGTCA
ATGCCGTCAGGGCTAGGATCGAGTTGGATCTGCGAATCGGCTGTGCCTTTACCAGGTTCCTCTGCAACAGTCTCC
GGTCGTTGGGCGGGCCCATGGAGAAGCTCACGCTGAGCTACGGTAAGGCGGGCCTCGACGGGTCCCGGGTACGGC
TCCTTGCTAACCAAACAGGATCGTGCCAGTTTCCTACGCTTGGCTTCGTGGTCGATCGATATTTTCGCGTCAAGA
ACTTTGTGCCCGAGCCCTTTTGGAGCATCAAGCTCACGCATACCAAGGAGGGAAAGACGGCCGTCTTCACTTGGG
CGAGGAACCGTCTCTTCGATCGCACCACGACCGTCATCCTCTACGAGCGATGTCTTGCCGCTAAAAAGGCGGTGG
TGACGAGGGTTCAGGAGAAGCCGACGCGCGAGTTTAAGCCATTGCCGCTCACGACGGTCGAGTTGCAAAAGGCGG
CGACCCGTCTGCTCCGCATGAACAGCCAGCGTGCCATGGTCATCGCCGAAGGGCTGTATAACAAGGGCTTCATTA
GCTATCCTCGTACCGAGACGGACCGCTTCGACAAGGGCATCAATCTCAGGGCCCTGGTGCAGAAACAGACGCCAA
GTCAAGCATGGGGCAACTTTGCTCAGGGCCTGGTCGACGGTGCTTTTCAGCAGCCTCGGGCGGGCAGAAACGATG
ACAAGGCGCATCCTCCGATTCATCCCATTGCCTACGCGGCACCGACGGTGCTCAGCGCCGAGGAGGCGCCCTTGT
ACGAGTACGTCGTTCGTCGCTTTCTTGCCTGCTGCGCAGATGACGCCAAAGGCATGGCGACGGATATAGACGTCG
AGTACGGGGACGAGCACTTTCATGCCCGTGGCGTCATCGTTTTGGAGAGGAATTATCTTGATGTCTTTATATACG
AGAGGTGGGATAACACGGCTGAGCTCCCAAGACTATCAAGGGGTGAGCAGTTTGAACCGACGGAAGCCATGATGA
CGCAAGGCAAGACGTCGCCGCCGAATTACCTGACGGAGGCGGACTTGATCGCGCTGATGGACGCCAACGGTATCG
GGACCGACGCCACAATGGCCGATCACATACAAAAGATTCAGGATCGGGAATACGTGGCCGTCATTGACAGGGCCA
GAAGCGGCGCGGGAGGCGATGATGACGAGAACGGAGACGGCCCGGGGGCCAGGGAGGAGGCTCCCGCCGGTCGCG
GACGAGGAAGCGGGCGGGGCCGGCGAGGCGGAAGGGGAGGCGCGGCATCGACCGGGAGGAGAGGCGGCCAAAAGG
TCTTTGTGCCGACTCAACTCGGGGTGGCACTGATCCTGGGTTTCGACCGCATGAACTTTGAGACGAGTCTGGGGA
AGCCGTTCCTACGCAAAGAGATGGAGCTCAAGATGAAGGCCATCTGCGAGGGCAACACGACCAGGGACATGGTGC
TGCGGGAGAGCATCTCTCAGTACCGGCATGTCTTTTTCCAGTCGCAAGAGAAGCTCGGGGTGCTTCGTCAGGTGA
GATGGCTGGTACGGAGGACTGACAGAAGAGAAGGGGAGCTGATTATTAGCCTGCAGGCTTGTCGCGAGTTTGTGT
TTGGGCAGCAGCCGCCGAACAGATGATGAAGAGCCGGCACGAGTCGCTATCCGTCAACAGCATTACGGCCCGATA
CCAGGCGGTGACGGACAGACAGCGAGTCGCGCGGCAGAGACGAGTCTGCGGCCAGCACGCGGCTTTCTGCACGAG
GCGGTCGGATCCGCACGCAGTGACGAGCCCCCTTGACCGATACGGAAGCCCAGGTCAGCTCGGGTCCGAGCCGGC
CGAGATGGGGCGGGCGACGGCGTGCAGGACGGTTCCTGATACGACCGAGGGAAGACGGTCAGCGGACGGGCTCAT
GTGAGCCTGCGGACCGGTCTTGGGCTGTCTATTCGTAGGTATGTCCGATGACGGTGAGGGGCGGGTGACAGGTGC
GGAAGATTCCGGGGGGAAGGAGGAGGGGGGTGAAACGTCAGATGAATTATTAATCGAGACAGGATTCGAAACGAG
ACAGCGTGTCTGACATGATGATGATGATGATGATGATGACGATGATGTTGTCGTCGAGGTGTCCTCTTGTCTGCG
GCTGATGCGAGGCTATCTCAGCCACGGCTAGGAATGGGGGCGCAGCAGCTAAGCCACAGCTTCATGCTAAGAGCG
TGCATGCAGTAGCATGTACCTATCTAGGTACCCACTTACCTATCTACCTAGGTAGGTAGGTAGATATCTAGGTAC
TAGGTGCCAAGCCAGGACGGACGATTGACAGGTTGGAGCAACGACACTCCAGAATCATCAGCGATGGAGTCAGAG
CAAACAGAGAGTTTCCGTTCGTATGTGTGTATGTATTCTGATGTCAGTATGCAATGTACGTGCAGTCAGTCATGA
TGTACTCTGAGCAATGCGTTTCGTCCATATATAGCAGCCATGGTCGGTGCGTTGGGGCGAGGCCAAACAGCCCTA
CACTTTTTAGGTACAGACTTGATTCCGGCGGGTACCGGGTACGTCCAACGAGGTACACACCCTTTTGGCCGTGCT
CCTCCTCCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCCTCTCTCCTCCTTCCCTCGCCATCACCATCCCCTT
GATCTGAACCATCGAGAACCGTGTCGTCACAGTCCGCCAGCATCACGTCAGCCCTTCGCCAGCCTCTTGTTCGTC
GCTCCCTTCATCGAAGAATCTCAACAAACCAACGTCTCATCAGATACGTACCCGCACCCCCCCCCCGGGCCTGGG
GTCCGCTTCGCCTCGGGCCAACGTGACGCTGCGCTCGTGTCGCGTCACTTGTCAAGTTGTTCACTGACGTCGCCT
TTACAGACCTCGTCGCTCTCACAACAAGATGGCATCGGCTGCTCGCGATATCCCAAAGGCCGCCTCGATGACCCG
AGACAGCTTGACTGCTGTAGCGGAACGAGGCGAGCCGGCGACTGTGGCTCCAACTTCTCGTGCCCTCCCTACACC
CCCAAACTCCATCTCCCCCGCCCTGCCGGCCCACGGTCTCAAGGCTCAGCTCCGGAGGGCCAGGCTCGAACCCAT
CGACTCGGACCTCGACCTGGCCGACGCCGACGCCGGCATACGGCCCCCTTCAACGGCCATGTACGAGGCCTCGGG
CGCCATCACTAGCGCCATGCTCGCCAAATACCACCTGCCCGAGATACTCATCAATCATGGTCCTCTGGCCATCCG
ACACATCGTCGGATACCTGACCACGTCCGTGCCGGGCTTCTCCGGAATCCCCCCCAATAAAGCCCGACGTCTCGT
CGTCGCCGCTCTCGACGGCCGCCGGGACGCCGACGATGCCGAGGGGACCGTCGAATTCGAAAAGGTGGGCTGGGG
GCGGTGGAATGCTCGTCGGCGAGGCTCCGTCGATCCTCGGGCCACTTCGTCATCGGCCCCGAGCGGCGCCGCCAT
TCCCATCTCCCGCGTCAGCACCCGGAGTCAGCACAGGGCCAGGGCCGAGGCCTCTAGGTCGATGGGGGATGACTC
CATCAACTTCTCGCCCCACCACCTCGACGACACGCATATGATGGGCACGGACGCCGACAGGATGTCCATGGACGG
CTCGGCCTCGGCCTCATGCTCCGAGGCCCCCGACGACGAGGTGGCCATCAACGACGACCCGGATGACGTGACTGA
CGACGAGGACTGGGCGGCCATGGGCGCGGCCGCCCTCCGGGCCGAGTCGTATCCCAGCATGGCGGCCGCCCGATG
TGACGGCGACTTCAAATTCGCCACCAGGCTGCGACAGTTCGCATCGACGGGCTCGGGCATGGCGCGTCCGCCCGC
GCATTTCGCCTTGTCTGCCCTAGTGGACGCGTCCGATGCCCAGGAGCGTGAGGCCGTCGAGGCCCTCCTCCGGCT
CGGTTCTGTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail