Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04458
Gene name
Locationscaffold_04:3290012..3294959
Strand-
Gene length (bp)4947
Transcript length (bp)3459
Coding sequence length (bp)3459
Protein length (aa) 1153

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00806 PUF Pumilio-family RNA binding repeat 3.9E-10 433 466
PF00806 PUF Pumilio-family RNA binding repeat 7.0E-07 470 499
PF00806 PUF Pumilio-family RNA binding repeat 1.4E-06 505 538
PF00806 PUF Pumilio-family RNA binding repeat 8.8E-04 544 572
PF00806 PUF Pumilio-family RNA binding repeat 5.4E-12 578 611
PF00806 PUF Pumilio-family RNA binding repeat 9.2E-05 617 644
PF00806 PUF Pumilio-family RNA binding repeat 1.8E-08 649 678
PF00806 PUF Pumilio-family RNA binding repeat 3.4E-05 698 725
PF07798 CCDC90-like Coiled-coil domain-containing protein 90-like 2.4E-46 941 1115

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 1099 1118 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04458
MAAATRSRGFPSLTMPPASGEKAQQPITFPYSNKSIWNSSFTSAREKPIGSKDSDASPSGSSALNANSEADLWSS
SSNNPWNPEHPGRSVSTSPSRPRDGVNAAGYFDHAMTINKASRPFHHDDHNPYVAPFSSAQGRSDAYMDPLVALS
HHRDASLPPSRHSQTSPIYHDLYRAGHTPSNSIQSQRPLPATSFSSQSVNQRAFNLNKQLDDDLSAHFSRRMGLD
GPSSYAQPAAAPFQFNPGSQPWVGADGRYTDVTDPVSAQYASLKRSPVDRVSPGPSYRLESGSRAYAPPGSDSWP
AAKQPSSRDARPQSDFERRAPAVPPPTSLANYHPSFFPGQFPYGAAAGLPSQYAGSYLDPYGQNNSFRHHPMMAS
YGLHAVHAGNYPLGANMPPVRPSRDQDSAKGMRSALLDEFRLSNKSSKRYELKDIYNHVVEFSGDQHGSRFIQQK
LESANSDEKEQVFREIEPNAIQLMKDVFGNYVVQKFFEHGNQVQKRVLAEKMKGKVVDLSVQVYACRVVQKALEH
VLVEQQAELTKELEPEILRVTRDQNGNHVVQKIIELVPRQYIDFIVGSLHGQVTGLASHMYGCRVIQRMLEHGTD
ADKHDIMVELHASAQILITDQYGNYVAQHVIQNGKHEDRQRMIELVMAQLLTLSKHKFASNVVEKCIEYGTGEQR
TAIRKQFTAAGGDGVSPLQQMIRDQYGNYVIQKLLGQLSGPERDTLVEDIKPQFFSLKRNGATRQLQALEKLLGL
GAGVKSETTPSHADASSASVTPVLTNETNSPQSSSPQSAHVGSVGFPSSVILGKEARMTVAPKTTNGRMASARLA
LTRLARWRARPLASRRAEASFAPRHGKAIEPEGREKTVEKTVEKTVEKTVEKGQVAASGELLPAPDPSKDDSPKD
GSSENKASDAAEPGQMMAMVESPRLRRTQPQMAPPPYVHHFDSYSLVKQLQKGGYTEKQATTAMKGIRALLASNL
DVAQDSLVSRSDVENESYLFTAACSELSTEIKNNRRLQHEATRQARTVLQHEVDILTQSLSQELVTLNDNVRGMF
NDRNMTVREEQKGVESAIQKINYKMSILLSSDCKSEIEGVRWILIRRSVLGILFMAMFALAVLRYASFLAKRRGE
EERERRAGGSWRGALWRRRGFGGGGVT*
Coding >Ophcf2|04458
ATGGCCGCTGCTACTCGATCGAGGGGCTTTCCCAGCCTCACCATGCCCCCCGCCTCGGGCGAAAAGGCCCAGCAG
CCCATCACCTTTCCCTACTCCAACAAGAGCATCTGGAACTCGTCCTTCACCAGCGCCCGCGAGAAGCCCATCGGC
TCCAAAGACTCCGACGCAAGCCCCTCGGGCTCCAGCGCCCTCAACGCAAACTCCGAGGCCGATCTCTGGAGCTCC
AGCTCCAACAATCCCTGGAACCCCGAGCATCCGGGTCGCTCCGTCAGCACCTCGCCCAGCCGTCCCCGCGATGGC
GTCAACGCAGCAGGCTACTTCGACCATGCCATGACCATCAACAAGGCCTCCAGGCCCTTCCATCACGACGACCAC
AACCCTTACGTCGCCCCCTTCTCCTCCGCCCAGGGCCGCTCCGACGCCTACATGGACCCCTTGGTCGCCTTGTCC
CACCACCGCGACGCCAGCCTACCGCCCTCGCGCCACTCCCAGACCTCGCCCATCTACCACGACCTCTACCGCGCC
GGCCACACCCCCAGCAACTCCATCCAGTCCCAGCGACCCCTGCCCGCCACCTCCTTCTCCTCCCAGAGCGTCAAC
CAGCGTGCCTTTAACCTCAACAAGCAGCTCGACGACGACCTCTCCGCGCACTTCAGTCGCCGCATGGGCCTCGAC
GGGCCCTCGTCCTACGCCCAGCCCGCCGCCGCCCCCTTCCAGTTCAACCCGGGTTCCCAGCCCTGGGTCGGCGCC
GACGGCCGCTATACCGACGTCACCGATCCCGTCAGCGCCCAGTACGCCTCCCTGAAACGCTCCCCCGTCGACAGG
GTCTCGCCCGGCCCCAGCTACCGCCTCGAGTCCGGCTCTCGCGCCTACGCGCCTCCGGGCTCCGACTCGTGGCCC
GCCGCCAAGCAGCCTTCCTCGCGCGATGCCCGTCCCCAATCCGACTTTGAACGACGCGCCCCCGCCGTACCCCCT
CCGACGTCCCTCGCCAACTACCACCCTTCATTCTTCCCCGGTCAGTTCCCCTACGGCGCCGCCGCCGGCCTCCCC
TCGCAGTACGCCGGCAGCTACCTGGACCCGTACGGCCAGAACAACTCGTTCCGTCACCACCCCATGATGGCCAGC
TACGGTCTCCACGCCGTCCACGCCGGCAACTACCCGCTCGGCGCCAACATGCCGCCCGTCCGGCCCTCGCGCGAC
CAGGACTCGGCCAAGGGAATGCGTAGCGCCCTGCTGGACGAGTTCCGCCTCAGCAACAAATCGAGCAAGCGGTAC
GAGCTCAAGGACATCTACAACCACGTCGTCGAGTTCAGCGGCGACCAGCACGGCTCCCGCTTCATCCAACAGAAG
CTCGAGTCGGCCAACAGCGACGAGAAGGAGCAGGTCTTCCGCGAGATCGAGCCCAACGCCATCCAGCTGATGAAG
GACGTCTTCGGAAACTACGTGGTGCAAAAGTTCTTCGAGCACGGTAACCAGGTCCAGAAGCGTGTGCTGGCCGAG
AAGATGAAGGGCAAGGTGGTGGACCTCTCGGTTCAGGTCTACGCCTGCCGCGTCGTCCAAAAGGCTCTCGAGCAC
GTCCTGGTCGAGCAGCAGGCCGAGCTGACCAAGGAGCTCGAGCCCGAGATCCTGCGGGTGACGCGCGACCAGAAC
GGCAATCACGTGGTGCAAAAGATCATCGAGCTCGTGCCGCGTCAGTACATCGACTTCATCGTCGGCTCCCTGCAC
GGCCAGGTGACGGGTCTTGCCTCCCACATGTACGGCTGCCGCGTCATCCAGCGCATGCTCGAGCACGGCACCGAC
GCCGACAAGCACGACATCATGGTGGAGCTGCACGCCTCTGCCCAGATCCTCATCACGGATCAGTACGGCAACTAC
GTGGCCCAGCACGTCATCCAGAACGGGAAGCACGAGGACCGCCAGCGCATGATTGAGCTGGTCATGGCCCAGCTG
CTGACGCTGTCCAAGCACAAGTTTGCCTCCAACGTGGTGGAAAAGTGCATCGAGTACGGCACGGGCGAGCAGCGG
ACCGCGATCCGGAAGCAGTTTACGGCCGCGGGCGGCGACGGCGTGAGCCCGCTGCAGCAGATGATCCGCGACCAG
TACGGCAACTACGTGATCCAGAAACTATTGGGTCAGCTTTCCGGCCCGGAGCGGGACACGCTGGTCGAGGACATC
AAGCCGCAGTTCTTCTCGCTCAAGAGGAACGGCGCCACCAGGCAGCTCCAGGCGCTCGAGAAGCTGCTGGGGCTC
GGGGCCGGTGTCAAGAGCGAGACGACACCTTCGCACGCAGACGCCAGCTCGGCCTCGGTCACGCCCGTCCTGACC
AACGAGACCAACAGCCCGCAGAGCAGCAGCCCGCAGAGCGCCCACGTCGGCTCCGTCGGCTTCCCCAGCTCCGTC
ATTCTGGGCAAGGAGGCGAGGATGACGGTGGCTCCCAAGACGACGAATGGAAGGATGGCGTCGGCCAGGCTGGCC
CTGACGAGGCTTGCGCGATGGCGGGCTCGACCGCTGGCTTCTCGACGGGCCGAGGCTTCGTTTGCGCCCCGGCAT
GGCAAGGCGATTGAGCCTGAAGGAAGGGAGAAGACCGTGGAGAAGACCGTGGAGAAGACCGTGGAGAAGACCGTG
GAGAAGGGGCAGGTTGCGGCTTCGGGGGAGCTCCTCCCAGCGCCGGACCCTTCCAAGGACGACTCTCCCAAGGAC
GGCTCCTCCGAGAACAAGGCGTCGGACGCGGCGGAACCGGGACAGATGATGGCCATGGTTGAATCGCCGCGTCTA
CGAAGGACGCAGCCTCAGATGGCGCCGCCGCCTTATGTCCATCACTTTGACAGCTATTCTCTCGTCAAGCAGCTT
CAGAAGGGGGGCTATACGGAGAAACAGGCCACGACGGCCATGAAGGGGATTCGCGCGCTGCTCGCGTCCAACTTG
GATGTTGCGCAGGACAGTTTGGTGAGCAGAAGCGATGTTGAGAACGAGAGCTATCTGTTTACGGCGGCGTGCTCG
GAGCTTAGCACTGAGATTAAGAATAATCGTCGGTTGCAGCATGAGGCTACGAGGCAGGCGAGGACGGTGTTGCAG
CATGAGGTGGATATCTTGACGCAGAGCCTTAGCCAGGAGTTGGTCACGTTGAATGATAATGTCAGGGGGATGTTT
AATGATCGGAATATGACGGTCAGGGAGGAGCAGAAGGGTGTCGAGAGCGCGATCCAAAAGATTAACTACAAGATG
AGCATCCTTCTCAGCAGCGACTGCAAGTCTGAGATTGAGGGCGTTCGATGGATTCTGATCCGGAGGTCTGTGCTG
GGGATACTGTTCATGGCCATGTTCGCCTTGGCGGTCCTGCGGTATGCTTCTTTTCTGGCGAAGAGGAGGGGGGAG
GAGGAGAGGGAGAGGAGGGCGGGAGGGTCTTGGAGAGGAGCCTTGTGGAGGAGGAGGGGCTTTGGTGGCGGCGGG
GTTACCTAG
Transcript >Ophcf2|04458
ATGGCCGCTGCTACTCGATCGAGGGGCTTTCCCAGCCTCACCATGCCCCCCGCCTCGGGCGAAAAGGCCCAGCAG
CCCATCACCTTTCCCTACTCCAACAAGAGCATCTGGAACTCGTCCTTCACCAGCGCCCGCGAGAAGCCCATCGGC
TCCAAAGACTCCGACGCAAGCCCCTCGGGCTCCAGCGCCCTCAACGCAAACTCCGAGGCCGATCTCTGGAGCTCC
AGCTCCAACAATCCCTGGAACCCCGAGCATCCGGGTCGCTCCGTCAGCACCTCGCCCAGCCGTCCCCGCGATGGC
GTCAACGCAGCAGGCTACTTCGACCATGCCATGACCATCAACAAGGCCTCCAGGCCCTTCCATCACGACGACCAC
AACCCTTACGTCGCCCCCTTCTCCTCCGCCCAGGGCCGCTCCGACGCCTACATGGACCCCTTGGTCGCCTTGTCC
CACCACCGCGACGCCAGCCTACCGCCCTCGCGCCACTCCCAGACCTCGCCCATCTACCACGACCTCTACCGCGCC
GGCCACACCCCCAGCAACTCCATCCAGTCCCAGCGACCCCTGCCCGCCACCTCCTTCTCCTCCCAGAGCGTCAAC
CAGCGTGCCTTTAACCTCAACAAGCAGCTCGACGACGACCTCTCCGCGCACTTCAGTCGCCGCATGGGCCTCGAC
GGGCCCTCGTCCTACGCCCAGCCCGCCGCCGCCCCCTTCCAGTTCAACCCGGGTTCCCAGCCCTGGGTCGGCGCC
GACGGCCGCTATACCGACGTCACCGATCCCGTCAGCGCCCAGTACGCCTCCCTGAAACGCTCCCCCGTCGACAGG
GTCTCGCCCGGCCCCAGCTACCGCCTCGAGTCCGGCTCTCGCGCCTACGCGCCTCCGGGCTCCGACTCGTGGCCC
GCCGCCAAGCAGCCTTCCTCGCGCGATGCCCGTCCCCAATCCGACTTTGAACGACGCGCCCCCGCCGTACCCCCT
CCGACGTCCCTCGCCAACTACCACCCTTCATTCTTCCCCGGTCAGTTCCCCTACGGCGCCGCCGCCGGCCTCCCC
TCGCAGTACGCCGGCAGCTACCTGGACCCGTACGGCCAGAACAACTCGTTCCGTCACCACCCCATGATGGCCAGC
TACGGTCTCCACGCCGTCCACGCCGGCAACTACCCGCTCGGCGCCAACATGCCGCCCGTCCGGCCCTCGCGCGAC
CAGGACTCGGCCAAGGGAATGCGTAGCGCCCTGCTGGACGAGTTCCGCCTCAGCAACAAATCGAGCAAGCGGTAC
GAGCTCAAGGACATCTACAACCACGTCGTCGAGTTCAGCGGCGACCAGCACGGCTCCCGCTTCATCCAACAGAAG
CTCGAGTCGGCCAACAGCGACGAGAAGGAGCAGGTCTTCCGCGAGATCGAGCCCAACGCCATCCAGCTGATGAAG
GACGTCTTCGGAAACTACGTGGTGCAAAAGTTCTTCGAGCACGGTAACCAGGTCCAGAAGCGTGTGCTGGCCGAG
AAGATGAAGGGCAAGGTGGTGGACCTCTCGGTTCAGGTCTACGCCTGCCGCGTCGTCCAAAAGGCTCTCGAGCAC
GTCCTGGTCGAGCAGCAGGCCGAGCTGACCAAGGAGCTCGAGCCCGAGATCCTGCGGGTGACGCGCGACCAGAAC
GGCAATCACGTGGTGCAAAAGATCATCGAGCTCGTGCCGCGTCAGTACATCGACTTCATCGTCGGCTCCCTGCAC
GGCCAGGTGACGGGTCTTGCCTCCCACATGTACGGCTGCCGCGTCATCCAGCGCATGCTCGAGCACGGCACCGAC
GCCGACAAGCACGACATCATGGTGGAGCTGCACGCCTCTGCCCAGATCCTCATCACGGATCAGTACGGCAACTAC
GTGGCCCAGCACGTCATCCAGAACGGGAAGCACGAGGACCGCCAGCGCATGATTGAGCTGGTCATGGCCCAGCTG
CTGACGCTGTCCAAGCACAAGTTTGCCTCCAACGTGGTGGAAAAGTGCATCGAGTACGGCACGGGCGAGCAGCGG
ACCGCGATCCGGAAGCAGTTTACGGCCGCGGGCGGCGACGGCGTGAGCCCGCTGCAGCAGATGATCCGCGACCAG
TACGGCAACTACGTGATCCAGAAACTATTGGGTCAGCTTTCCGGCCCGGAGCGGGACACGCTGGTCGAGGACATC
AAGCCGCAGTTCTTCTCGCTCAAGAGGAACGGCGCCACCAGGCAGCTCCAGGCGCTCGAGAAGCTGCTGGGGCTC
GGGGCCGGTGTCAAGAGCGAGACGACACCTTCGCACGCAGACGCCAGCTCGGCCTCGGTCACGCCCGTCCTGACC
AACGAGACCAACAGCCCGCAGAGCAGCAGCCCGCAGAGCGCCCACGTCGGCTCCGTCGGCTTCCCCAGCTCCGTC
ATTCTGGGCAAGGAGGCGAGGATGACGGTGGCTCCCAAGACGACGAATGGAAGGATGGCGTCGGCCAGGCTGGCC
CTGACGAGGCTTGCGCGATGGCGGGCTCGACCGCTGGCTTCTCGACGGGCCGAGGCTTCGTTTGCGCCCCGGCAT
GGCAAGGCGATTGAGCCTGAAGGAAGGGAGAAGACCGTGGAGAAGACCGTGGAGAAGACCGTGGAGAAGACCGTG
GAGAAGGGGCAGGTTGCGGCTTCGGGGGAGCTCCTCCCAGCGCCGGACCCTTCCAAGGACGACTCTCCCAAGGAC
GGCTCCTCCGAGAACAAGGCGTCGGACGCGGCGGAACCGGGACAGATGATGGCCATGGTTGAATCGCCGCGTCTA
CGAAGGACGCAGCCTCAGATGGCGCCGCCGCCTTATGTCCATCACTTTGACAGCTATTCTCTCGTCAAGCAGCTT
CAGAAGGGGGGCTATACGGAGAAACAGGCCACGACGGCCATGAAGGGGATTCGCGCGCTGCTCGCGTCCAACTTG
GATGTTGCGCAGGACAGTTTGGTGAGCAGAAGCGATGTTGAGAACGAGAGCTATCTGTTTACGGCGGCGTGCTCG
GAGCTTAGCACTGAGATTAAGAATAATCGTCGGTTGCAGCATGAGGCTACGAGGCAGGCGAGGACGGTGTTGCAG
CATGAGGTGGATATCTTGACGCAGAGCCTTAGCCAGGAGTTGGTCACGTTGAATGATAATGTCAGGGGGATGTTT
AATGATCGGAATATGACGGTCAGGGAGGAGCAGAAGGGTGTCGAGAGCGCGATCCAAAAGATTAACTACAAGATG
AGCATCCTTCTCAGCAGCGACTGCAAGTCTGAGATTGAGGGCGTTCGATGGATTCTGATCCGGAGGTCTGTGCTG
GGGATACTGTTCATGGCCATGTTCGCCTTGGCGGTCCTGCGGTATGCTTCTTTTCTGGCGAAGAGGAGGGGGGAG
GAGGAGAGGGAGAGGAGGGCGGGAGGGTCTTGGAGAGGAGCCTTGTGGAGGAGGAGGGGCTTTGGTGGCGGCGGG
GTTACCTAG
Gene >Ophcf2|04458
ATGGCCGCTGCTGTGAGTTTCCTTTTGCCGCTTTTCTTCAATCCTCTACCCGAGCGCTGTTTAGCGCACCTTGAG
GGGGCTCGTGGGTGTCTCAAGGTTGCACCAAATTAGTGCGTGTGTGCCCAGCACGACGCTTAGTCTGCCTTGCCC
CAAGGGTCCTTGCTAGAGCCGAGAGAACCCTCGACCCCATCACGTTTCTTTCCCCCCCCCCACGTTCGCCATTTT
TTTATTTTTTTATTTTTTGCCCACTTGCTTAATTGTTTCCTCGCTGACCTTTGCCTCTTCTCCCCTCGCCTACAG
ACTCGATCGAGGGGCTTTCCCAGCCTCACCATGCCCCCCGCCTCGGGCGAAAAGGCCCAGCAGCCCATCACCTTT
CCCTACTCCAACAAGAGCATCTGGAACTCGTCCTTCACCAGCGCCCGCGAGAAGCCCATCGGCTCCAAAGGTCCT
TTCCAACCGCCCCGACTACCGACTCCCGACGCTCACCCTTGCCCAGACTCCGACGCAAGCCCCTCGGGCTCCAGC
GCCCTCAACGCAAACTCCGAGGCCGATCTCTGGAGCTCCAGCTCCAACAATCCCTGGAACCCCGAGCATCCGGGT
CGCTCCGTCAGCACCTCGCCCAGCCGTCCCCGCGATGGCGTCAACGCAGCAGGCTACTTCGACCATGCCATGACC
ATCAACAAGGCCTCCAGGCCCTTCCATCACGACGACCACAACCCTTACGTCGCCCCCTTCTCCTCCGCCCAGGGC
CGCTCCGACGCCTACATGGACCCCTTGGTCGCCTTGTCCCACCACCGCGACGCCAGCCTACCGCCCTCGCGCCAC
TCCCAGACCTCGCCCATCTACCACGACCTCTACCGCGCCGGCCACACCCCCAGCAACTCCATCCAGTCCCAGCGA
CCCCTGCCCGCCACCTCCTTCTCCTCCCAGAGCGTCAACCAGCGTGCCTTTAACCTCAACAAGCAGCTCGACGAC
GACCTCTCCGCGCACTTCAGTCGCCGCATGGGCCTCGACGGGCCCTCGTCCTACGCCCAGCCCGCCGCCGCCCCC
TTCCAGTTCAACCCGGGTTCCCAGCCCTGGGTCGGCGCCGACGGCCGCTATACCGACGTCACCGATCCCGTCAGC
GCCCAGTACGCCTCCCTGAAACGCTCCCCCGTCGACAGGGTCTCGCCCGGCCCCAGCTACCGCCTCGAGTCCGGC
TCTCGCGCCTACGCGCCTCCGGGCTCCGACTCGTGGCCCGCCGCCAAGCAGCCTTCCTCGCGCGATGCCCGTCCC
CAATCCGACTTTGAACGACGCGCCCCCGCCGTACCCCCTCCGACGTCCCTCGCCAACTACCACCCTTCATTCTTC
CCCGGTCAGTTCCCCTACGGCGCCGCCGCCGGCCTCCCCTCGCAGTACGCCGGCAGCTACCTGGACCCGTACGGC
CAGAACAACTCGTTCCGTCACCACCCCATGATGGCCAGCTACGGTCTCCACGCCGTCCACGCCGGCAACTACCCG
CTCGGCGCCAACATGCCGCCCGTCCGGCCCTCGCGCGACCAGGACTCGGCCAAGGGAATGCGTAGCGCCCTGCTG
GACGAGTTCCGCCTCAGCAACAAATCGAGCAAGCGGTACGAGCTCAAGGACATCTACAACCACGTCGTCGAGTTC
AGCGGCGACCAGCACGGCTCCCGCTTCATCCAACAGAAGCTCGAGTCGGCCAACAGCGACGAGAAGGAGCAGGTC
TTCCGCGAGATCGAGCCCAACGCCATCCAGCTGATGAAGGACGTCTTCGGAAACTACGTGGTGCAAAAGTTCTTC
GAGCACGGTAACCAGGTCCAGAAGCGTGTGCTGGCCGAGAAGATGAAGGGCAAGGTGGTGGACCTCTCGGTTCAG
GTCTACGCCTGCCGCGTCGTCCAAAAGGCTCTCGAGCACGTCCTGGTCGAGCAGCAGGCCGAGCTGACCAAGGAG
CTCGAGCCCGAGATCCTGCGGGTGACGCGCGACCAGAACGGCAATCACGTGGTGCAAAAGATCATCGAGCTCGTG
CCGCGTCAGTACATCGACTTCATCGTCGGCTCCCTGCACGGCCAGGTGACGGGTCTTGCCTCCCACATGTACGGC
TGCCGCGTCATCCAGCGCATGCTCGAGCACGGCACCGACGCCGACAAGCACGACATCATGGTGGAGCTGCACGCC
TCTGCCCAGATCCTCATCACGGATCAGTACGGCAACTACGTGGCCCAGCACGTCATCCAGAACGGGAAGCACGAG
GACCGCCAGCGCATGATTGAGCTGGTCATGGCCCAGCTGCTGACGCTGTCCAAGCACAAGTTTGCCTCCAACGTG
GTGGAAAAGTGCATCGAGTACGGCACGGGCGAGCAGCGGACCGCGATCCGGAAGCAGTTTACGGCCGCGGGCGGC
GACGGCGTGAGCCCGCTGCAGCAGATGATCCGCGACCAGTACGGCAACTACGTGATCCGTGGGTCACCCTTTTGC
GGCGGAGGAAGCGATGAGAGAGACTGACTCGACTGACGCGTGATGCAGAGAAACTATTGGGTCAGCTTTCCGGCC
CGGAGCGGGACACGCTGGTCGAGGACATCAAGCCGCAGTTCTTCTCGCTCAAGAGGAACGGCGCCACCAGGCAGC
TCCAGGCGCTCGAGAAGCTGCTGGGGCTCGGGGCCGGTGTCAAGAGCGAGACGACACCTTCGCACGCAGACGCCA
GCTCGGCCTCGGTCACGCCCGTCCTGACCAACGAGACCAACAGCCCGCAGAGCAGCAGCCCGCAGAGCGCCCACG
TCGGCTCCGTCGGCTTCCCCAGCTCCGTCATTCTGGGCAAGGAGGCGAGGATGACGGTGGCTCCCAAGGTTCGGG
AAGATACCGACTGAGCCTGTATAATTTTGTTGTTTCTTTTTTTTGTTTCCTACTTTTACCCTTTTATCTTTTTTA
AACCCCCCCCCCCCCCCTTCTTTCCAGCGGAGCGCTTCTTGGGAGCCGACGCCAAGCGCTATAGATAATGTTTTC
GTGCAAAAAGCTTCTTACAGGAAACATACGGCATCGCTACTATATATCTTTTCTAAAAAAGCAAGACCAGGTACA
AGACAGGCCGGCCCGGTCGAGAAAGGCATGAACAGACAGGATTTTATGGTGGGCCGCTATCGCCAGCTTCACTCT
TTTTCTACCTATTTACATGATTTTTGGGCATCATCTCTATCTATATGGAAAGACGGGGGAAAGTAAAACCCCGGG
ATACTCTTCTTCTTTCTTCTTTCCGATACTTTCCCGTTTCCTTTTTTTTTTCTTCCCTCGTCTTTTTTGTTTTCT
CTTGTTTTCTATTTTTTAATCCTTTTGGGCTTTCCACCTTCTCGTAACTTGTTGTTTCGGTAACGGACTGGGTTG
CTCTCTCCTGGGTTTATGTACTGGTTAGTGGGAGGGATGGAAGGGGAGGATGGGGATGAATGGGGATGAATGGGA
TAAAGGAGAGGGTCCGGGATGTACTTTATGGGGAGTGAGGAAGTGGAATGTGAGTGCTTCGTGTCTGAAGAGGAA
TTACTCTATGTGAAGAAGGAACTGCTCGGTTCTTCTGTCAAGGAGAATGCCTTTTGTTTCCTGGACCAGAGACGA
CTTTACCTACGGTGTTTCTCTATGAAGTAACAGCAGATAGACGATGACTCAGCTGTGACGCCATCACATGCTTTA
GGCACAAGTAGGTATGTTAATGTATTCGTATGCAGGTATGTATATGGTGTTCGTACCTACCTGCGAATACAGAGG
GCGGAGAGGCTTTTTTCCGACAACAGCATCCGACGACGAAGAGCAAAGCCGGCAAGACGACGAATGGAAGGATGG
CGTCGGCCAGGCTGGCCCTGACGAGGCTTGCGCGATGGCGGGCTCGACCGCTGGCTTCTCGACGGGCCGAGGCTT
CGTTTGCGCCCCGGCATGGCAAGGCGATTGAGCCTGAAGGAAGGGAGAAGACCGTGGAGAAGACCGTGGAGAAGA
CCGTGGAGAAGACCGTGGAGAAGGGGCAGGTTGCGGCTTCGGGGGAGCTCCTCCCAGCGCCGGACCCTTCCAAGG
ACGACTCTCCCAAGGACGGCTCCTCCGAGAACAAGGCGTCGGACGCGGCGGAACCGGGACAGATGATGGCCATGG
TTGAATCGCCGCGTCTACGAAGGACGCAGCCTCAGATGGCGCCGCCGCCTTATGTCCATCACTTTGACAGCTATT
CTCTCGTCAAGCAGCTTCAGAAGGGGGGCTATACGGAGAAACAGGCCACGACGGCCATGAAGGGGATTCGCGCGC
TGCTCGCGTCCAACTTGGATGTTGCGCAGGACAGTTTGGTGAGCAGAAGCGATGTTGAGAACGTGCGTCCCCCTT
TGCCACACTTTGGTACTATACATATGAAAGAAGAAGCTGACTAAGGAGTGGTGATAGGAGAGCTATCTGTTTACG
GCGGCGTGCTCGGAGCTTAGCACTGAGATTAAGAATAATCGTCGGTTGCAGCATGAGGCTACGAGGCAGGCGAGG
ACGGTGTTGCAGCATGAGGTGGATATCTTGACGCAGAGCCTTAGCCAGGAGTTGGTCACGTTGAATGATAATGTC
AGGGGGATGTTTAATGATCGGAATATGACGGTCAGGGAGGAGCAGAAGGGTGTCGAGAGCGCGGTGAGTCTGTCC
CAAGTTGTTGGAGGGGGAGGGGTTCGCTGACGGACGCAGATCCAAAAGATTAACTACAAGATGAGCATCCTTCTC
AGCAGCGACTGCAAGTCTGAGATTGAGGGCGTTCGATGGATTCTGATCCGGAGGTCTGTGCTGGGGATACTGTTC
ATGGCCATGTTCGCCTTGGCGGTCCTGCGGTATGCTTCTTTTCTGGCGAAGAGGAGGGGGGAGGAGGAGAGGGAG
AGGAGGGCGGGAGGGTCTTGGAGAGGAGCCTTGTGGAGGAGGAGGGGCTTTGGTGGCGGCGGGGTTACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail