Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04445
Gene name
Locationscaffold_04:3255260..3258760
Strand-
Gene length (bp)3500
Transcript length (bp)3393
Coding sequence length (bp)3393
Protein length (aa) 1131

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08424 NRDE-2 NRDE-2, necessary for RNA interference 6.6E-95 368 682

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.0573 0.9805 0.0156 0.0174 0.0298 0.0197 0.0184 0.055 0.0201 0.0229

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4163
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3301
Ophiocordyceps australis map64 (Brazil) OphauB2|4137
Ophiocordyceps camponoti-floridani Ophcf2|04445 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1767
Ophiocordyceps kimflemingae Ophio5|3687
Ophiocordyceps subramaniannii Hirsu2|8450

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04445
MADGDDDAKLRVPKFSSFKHKASGSAGDGPAEGELRVPKFSSFKSTEAISTSELRTGGRGLDETEELQRGKRKYD
GVDGEGESRLRRDGHRPEKRRHEEYRQEKHRYEKNRYEKHRHEEHRNEKRRQEKHRHEKHRHEKHHHDKHRRDEH
HHDNLRSRSHPDSHHRDTSRREKQHQRSGDSEKRRARTSLAESVPGLFVIDKKGDPLIRKYGLDRYRIPSYSRYG
GNRVLGTDGRLVIHRDGPVQKFSLLFPGQRLSDLLGERSSSSRDVGGLRSRDWIQRKAVRLRPRRDRIVDNDEEE
GYLRLESPRKRRRHHRHSGSSDGEDATPWRWIETKAKADDEEEEEEEEEEEASSESDVEEGDDPLRWKSSQLHRR
VKDHPDDIAGWLELVAHQDIILSGDNKGDNDVSENAARSISEVKVHLLESALSHASRPSDRETVLAALMREGVKI
WSRKVADKKWAQVSDDEHGSFELWKAHVDYAMSSITTVQYEAVKTMMMERLHQACSRALPSYSYEAIYVFLRATR
FIHDAGYKELAVAAWQGLLELNLFRPEGIDNQTEALAIFRDFWESEVPRLGEEGAQGWRQYVQNGGVGDAPDPVN
NVEPVDAPQQDPYDAWGAAEGLCGKRASMPARTMDGGTDEDPFRVVMYSDIEPLMFLLPQSELEEATGELVDAYL
LFCGLSPAFRGGVAIEKARHDQFVVRSCGNIQLQPIWEAEGGDDNTWTRKPPLFDGGFCQLNMSASLLFSGSAWF
RYLNVAGEDHVVDLSWVQSTLKQLVYSAGLSSLAVYYLGLCFARDAGSIRKHAKPLLKRYPTDVCLYNGYALAEF
ANGNAELAIKVLASAVESQALAAPSTGYILFKTWSWIELQRGNKELATRRLCAAVDGSLRTDEGVVSPSVLTEAR
GEFRSRSSWSLDEGYWQAATSHIECLALLAYLTDEGGSEPASKSQGNISAAIEVFASAVDGDGLGPFANELMLQC
ASRMLYFHSTKGPFRRAFMREQLAGFIDKFPRNTMFISLFAWADTGVGVKDETRRLLADKVLTKTHDAVGSRLFA
VSHELTRGNAQRTRAALQQAVSSEACRRSTTLWLRYVRFCRSQASLRAGASEVLYRALGSCPWSKELMMEAFSSG
LGGGS*
Coding >Ophcf2|04445
ATGGCCGACGGCGACGATGACGCGAAGCTGAGGGTTCCCAAGTTCTCATCTTTCAAGCACAAGGCGTCGGGGTCG
GCTGGTGATGGACCTGCGGAGGGGGAGCTGAGGGTTCCTAAGTTTTCGTCTTTCAAGTCTACGGAGGCGATTTCG
ACGTCGGAGTTGCGGACAGGGGGGAGGGGGCTTGATGAGACTGAGGAGTTGCAGAGGGGGAAACGGAAATATGAT
GGGGTGGATGGGGAGGGTGAGAGTCGTCTGCGGCGAGATGGGCATCGACCGGAGAAGCGTCGTCACGAGGAGTAT
CGCCAGGAGAAGCATCGATATGAGAAGAATCGGTATGAGAAGCATCGTCACGAGGAGCATCGAAACGAGAAGCGT
CGCCAAGAGAAGCATCGGCATGAGAAGCACCGTCACGAGAAGCATCATCATGATAAGCATCGCCGCGATGAGCAT
CACCACGATAATCTTCGCTCACGCTCCCATCCTGACTCTCATCACCGCGATACATCACGCAGAGAAAAGCAGCAT
CAGCGCTCTGGGGATTCAGAAAAGCGACGAGCTCGCACCAGCCTCGCAGAATCGGTGCCCGGTCTCTTCGTAATT
GACAAGAAAGGCGATCCCCTCATCAGAAAATACGGTTTAGACCGCTACAGGATACCCTCTTACTCTCGCTACGGT
GGCAACAGAGTGCTGGGAACAGATGGACGCCTCGTCATCCACAGAGACGGACCGGTGCAAAAATTCAGCCTCTTG
TTTCCTGGGCAACGACTATCCGACCTCCTCGGTGAGCGGTCGTCAAGCAGCCGCGACGTAGGCGGATTGCGATCC
CGAGATTGGATACAGCGCAAGGCCGTGAGACTTCGCCCTCGACGGGATAGGATTGTCGACAACGACGAAGAAGAG
GGCTATTTGCGTCTGGAGAGTCCGCGGAAGCGCCGGCGACACCATCGTCACAGCGGATCATCTGATGGAGAAGAC
GCGACGCCTTGGAGATGGATAGAGACCAAGGCTAAAGCAGATGACGAGGAGGAGGAGGAGGAGGAGGAGGAGGAG
GAGGCGTCGAGCGAATCTGACGTGGAAGAAGGCGACGATCCTTTGCGATGGAAATCCAGCCAGCTTCACAGGCGT
GTCAAAGATCATCCGGACGATATAGCCGGCTGGCTCGAGTTGGTCGCTCACCAGGATATTATCCTATCTGGCGAC
AACAAGGGTGACAATGACGTTTCTGAAAACGCGGCTCGCAGCATCTCCGAGGTCAAGGTTCACCTACTCGAGTCA
GCGCTGTCACACGCGTCACGACCATCAGATCGCGAGACGGTTCTGGCTGCCCTCATGCGCGAAGGCGTCAAGATT
TGGAGCCGGAAAGTGGCCGACAAGAAGTGGGCGCAAGTCTCGGACGACGAGCATGGTAGTTTCGAGCTGTGGAAG
GCTCATGTTGACTATGCCATGTCGAGCATCACCACGGTTCAGTACGAGGCTGTCAAGACGATGATGATGGAGCGT
CTTCATCAAGCCTGCTCGCGAGCCCTTCCGTCGTATTCATACGAAGCCATCTACGTCTTCCTCAGGGCGACTAGA
TTCATCCACGATGCCGGCTACAAGGAGCTCGCCGTGGCGGCATGGCAAGGTCTTTTGGAGCTCAACCTGTTTAGA
CCGGAGGGCATCGATAACCAGACCGAGGCGCTGGCCATCTTTCGAGACTTCTGGGAGAGCGAGGTGCCTAGGCTG
GGCGAAGAGGGAGCGCAGGGCTGGAGGCAGTACGTTCAGAACGGCGGAGTGGGTGACGCTCCCGATCCTGTCAAC
AACGTCGAGCCCGTGGATGCGCCTCAGCAGGATCCTTACGATGCCTGGGGAGCGGCTGAAGGCCTCTGCGGGAAG
AGAGCTTCCATGCCGGCGAGGACGATGGATGGCGGCACGGACGAAGACCCGTTTAGAGTCGTCATGTACTCTGAC
ATCGAGCCGCTGATGTTTCTCCTTCCCCAGAGTGAGCTGGAGGAAGCCACTGGCGAGCTTGTCGACGCCTATCTC
CTCTTCTGCGGACTTTCACCCGCGTTTCGAGGCGGCGTGGCCATCGAGAAGGCGAGGCACGACCAGTTCGTGGTG
CGAAGCTGTGGCAATATCCAGCTGCAGCCGATCTGGGAGGCCGAGGGAGGAGACGACAACACTTGGACCAGGAAA
CCGCCTTTGTTCGACGGGGGTTTCTGCCAATTGAACATGTCGGCTAGCCTCCTCTTCAGCGGCAGCGCTTGGTTC
CGCTATCTTAACGTGGCGGGTGAGGATCATGTGGTTGATCTCTCATGGGTACAGTCCACGCTGAAGCAGCTTGTC
TACTCGGCTGGTCTGTCGAGTCTGGCGGTATACTACCTGGGTCTATGCTTCGCCAGAGACGCAGGGTCTATCAGG
AAACACGCAAAGCCCCTGTTGAAGCGGTATCCGACGGACGTGTGTCTCTATAACGGCTACGCGCTGGCCGAGTTT
GCCAATGGAAACGCCGAGTTGGCCATCAAAGTACTGGCTTCCGCTGTCGAGTCTCAGGCGTTGGCCGCTCCCTCG
ACGGGGTACATCCTCTTCAAGACGTGGAGCTGGATCGAGTTGCAGAGGGGCAACAAGGAGCTGGCCACGAGGCGT
CTCTGTGCAGCCGTCGATGGATCACTGCGGACGGACGAAGGCGTCGTCTCACCGTCGGTCTTGACTGAGGCGCGT
GGCGAGTTTCGGTCGAGGTCGTCATGGAGCCTGGACGAAGGATACTGGCAGGCGGCAACCAGCCACATCGAGTGC
CTGGCACTGCTGGCCTATCTCACCGACGAGGGGGGCTCTGAGCCAGCGTCGAAGAGCCAAGGCAATATCTCGGCA
GCCATCGAGGTCTTTGCGTCGGCTGTGGATGGCGACGGCTTGGGTCCGTTTGCCAATGAACTCATGCTTCAGTGT
GCCTCGAGGATGCTGTATTTCCACTCGACCAAGGGACCTTTCCGAAGAGCATTCATGCGGGAGCAGCTGGCGGGC
TTCATCGACAAGTTCCCCCGAAACACCATGTTCATAAGCCTCTTCGCATGGGCAGACACTGGCGTCGGAGTCAAG
GACGAGACACGACGACTACTGGCAGACAAAGTGCTGACCAAGACGCACGACGCAGTCGGCAGCAGACTCTTCGCC
GTCTCGCACGAGCTGACGCGCGGAAACGCCCAGCGCACGCGGGCAGCCCTCCAGCAAGCCGTCTCCAGCGAGGCG
TGCAGACGGAGCACGACGCTGTGGCTGCGGTACGTGCGCTTCTGCCGGTCGCAGGCGTCGCTGCGTGCTGGGGCG
AGCGAGGTGCTTTACAGGGCGCTGGGGAGCTGTCCTTGGTCCAAGGAGTTGATGATGGAGGCCTTTTCGTCGGGG
TTGGGAGGGGGGAGTTGA
Transcript >Ophcf2|04445
ATGGCCGACGGCGACGATGACGCGAAGCTGAGGGTTCCCAAGTTCTCATCTTTCAAGCACAAGGCGTCGGGGTCG
GCTGGTGATGGACCTGCGGAGGGGGAGCTGAGGGTTCCTAAGTTTTCGTCTTTCAAGTCTACGGAGGCGATTTCG
ACGTCGGAGTTGCGGACAGGGGGGAGGGGGCTTGATGAGACTGAGGAGTTGCAGAGGGGGAAACGGAAATATGAT
GGGGTGGATGGGGAGGGTGAGAGTCGTCTGCGGCGAGATGGGCATCGACCGGAGAAGCGTCGTCACGAGGAGTAT
CGCCAGGAGAAGCATCGATATGAGAAGAATCGGTATGAGAAGCATCGTCACGAGGAGCATCGAAACGAGAAGCGT
CGCCAAGAGAAGCATCGGCATGAGAAGCACCGTCACGAGAAGCATCATCATGATAAGCATCGCCGCGATGAGCAT
CACCACGATAATCTTCGCTCACGCTCCCATCCTGACTCTCATCACCGCGATACATCACGCAGAGAAAAGCAGCAT
CAGCGCTCTGGGGATTCAGAAAAGCGACGAGCTCGCACCAGCCTCGCAGAATCGGTGCCCGGTCTCTTCGTAATT
GACAAGAAAGGCGATCCCCTCATCAGAAAATACGGTTTAGACCGCTACAGGATACCCTCTTACTCTCGCTACGGT
GGCAACAGAGTGCTGGGAACAGATGGACGCCTCGTCATCCACAGAGACGGACCGGTGCAAAAATTCAGCCTCTTG
TTTCCTGGGCAACGACTATCCGACCTCCTCGGTGAGCGGTCGTCAAGCAGCCGCGACGTAGGCGGATTGCGATCC
CGAGATTGGATACAGCGCAAGGCCGTGAGACTTCGCCCTCGACGGGATAGGATTGTCGACAACGACGAAGAAGAG
GGCTATTTGCGTCTGGAGAGTCCGCGGAAGCGCCGGCGACACCATCGTCACAGCGGATCATCTGATGGAGAAGAC
GCGACGCCTTGGAGATGGATAGAGACCAAGGCTAAAGCAGATGACGAGGAGGAGGAGGAGGAGGAGGAGGAGGAG
GAGGCGTCGAGCGAATCTGACGTGGAAGAAGGCGACGATCCTTTGCGATGGAAATCCAGCCAGCTTCACAGGCGT
GTCAAAGATCATCCGGACGATATAGCCGGCTGGCTCGAGTTGGTCGCTCACCAGGATATTATCCTATCTGGCGAC
AACAAGGGTGACAATGACGTTTCTGAAAACGCGGCTCGCAGCATCTCCGAGGTCAAGGTTCACCTACTCGAGTCA
GCGCTGTCACACGCGTCACGACCATCAGATCGCGAGACGGTTCTGGCTGCCCTCATGCGCGAAGGCGTCAAGATT
TGGAGCCGGAAAGTGGCCGACAAGAAGTGGGCGCAAGTCTCGGACGACGAGCATGGTAGTTTCGAGCTGTGGAAG
GCTCATGTTGACTATGCCATGTCGAGCATCACCACGGTTCAGTACGAGGCTGTCAAGACGATGATGATGGAGCGT
CTTCATCAAGCCTGCTCGCGAGCCCTTCCGTCGTATTCATACGAAGCCATCTACGTCTTCCTCAGGGCGACTAGA
TTCATCCACGATGCCGGCTACAAGGAGCTCGCCGTGGCGGCATGGCAAGGTCTTTTGGAGCTCAACCTGTTTAGA
CCGGAGGGCATCGATAACCAGACCGAGGCGCTGGCCATCTTTCGAGACTTCTGGGAGAGCGAGGTGCCTAGGCTG
GGCGAAGAGGGAGCGCAGGGCTGGAGGCAGTACGTTCAGAACGGCGGAGTGGGTGACGCTCCCGATCCTGTCAAC
AACGTCGAGCCCGTGGATGCGCCTCAGCAGGATCCTTACGATGCCTGGGGAGCGGCTGAAGGCCTCTGCGGGAAG
AGAGCTTCCATGCCGGCGAGGACGATGGATGGCGGCACGGACGAAGACCCGTTTAGAGTCGTCATGTACTCTGAC
ATCGAGCCGCTGATGTTTCTCCTTCCCCAGAGTGAGCTGGAGGAAGCCACTGGCGAGCTTGTCGACGCCTATCTC
CTCTTCTGCGGACTTTCACCCGCGTTTCGAGGCGGCGTGGCCATCGAGAAGGCGAGGCACGACCAGTTCGTGGTG
CGAAGCTGTGGCAATATCCAGCTGCAGCCGATCTGGGAGGCCGAGGGAGGAGACGACAACACTTGGACCAGGAAA
CCGCCTTTGTTCGACGGGGGTTTCTGCCAATTGAACATGTCGGCTAGCCTCCTCTTCAGCGGCAGCGCTTGGTTC
CGCTATCTTAACGTGGCGGGTGAGGATCATGTGGTTGATCTCTCATGGGTACAGTCCACGCTGAAGCAGCTTGTC
TACTCGGCTGGTCTGTCGAGTCTGGCGGTATACTACCTGGGTCTATGCTTCGCCAGAGACGCAGGGTCTATCAGG
AAACACGCAAAGCCCCTGTTGAAGCGGTATCCGACGGACGTGTGTCTCTATAACGGCTACGCGCTGGCCGAGTTT
GCCAATGGAAACGCCGAGTTGGCCATCAAAGTACTGGCTTCCGCTGTCGAGTCTCAGGCGTTGGCCGCTCCCTCG
ACGGGGTACATCCTCTTCAAGACGTGGAGCTGGATCGAGTTGCAGAGGGGCAACAAGGAGCTGGCCACGAGGCGT
CTCTGTGCAGCCGTCGATGGATCACTGCGGACGGACGAAGGCGTCGTCTCACCGTCGGTCTTGACTGAGGCGCGT
GGCGAGTTTCGGTCGAGGTCGTCATGGAGCCTGGACGAAGGATACTGGCAGGCGGCAACCAGCCACATCGAGTGC
CTGGCACTGCTGGCCTATCTCACCGACGAGGGGGGCTCTGAGCCAGCGTCGAAGAGCCAAGGCAATATCTCGGCA
GCCATCGAGGTCTTTGCGTCGGCTGTGGATGGCGACGGCTTGGGTCCGTTTGCCAATGAACTCATGCTTCAGTGT
GCCTCGAGGATGCTGTATTTCCACTCGACCAAGGGACCTTTCCGAAGAGCATTCATGCGGGAGCAGCTGGCGGGC
TTCATCGACAAGTTCCCCCGAAACACCATGTTCATAAGCCTCTTCGCATGGGCAGACACTGGCGTCGGAGTCAAG
GACGAGACACGACGACTACTGGCAGACAAAGTGCTGACCAAGACGCACGACGCAGTCGGCAGCAGACTCTTCGCC
GTCTCGCACGAGCTGACGCGCGGAAACGCCCAGCGCACGCGGGCAGCCCTCCAGCAAGCCGTCTCCAGCGAGGCG
TGCAGACGGAGCACGACGCTGTGGCTGCGGTACGTGCGCTTCTGCCGGTCGCAGGCGTCGCTGCGTGCTGGGGCG
AGCGAGGTGCTTTACAGGGCGCTGGGGAGCTGTCCTTGGTCCAAGGAGTTGATGATGGAGGCCTTTTCGTCGGGG
TTGGGAGGGGGGAGTTGA
Gene >Ophcf2|04445
ATGGCCGACGGCGACGATGACGCGAAGCTGAGGGTTCCCAAGTTCTCATCTTTCAAGCACAAGGCGTCGGGGTCG
GCTGGTGATGGACCTGCGGAGGGGGAGCTGAGGGTTCCTAAGTTTTCGTCTTTCAAGTCTACGGAGGCGATTTCG
ACGTCGGAGTTGCGGACAGGGGGGAGGGGGCTTGATGAGACTGAGGAGTTGCAGAGGGGGAAACGGAAATATGAT
GGGGTGGATGGGGAGGGTGAGAGTCGTCTGCGGCGAGATGGGCATCGACCGGAGAAGCGTCGTCACGAGGAGTAT
CGCCAGGAGAAGCATCGATATGAGAAGAATCGGTATGAGAAGCATCGTCACGAGGAGCATCGAAACGAGAAGCGT
CGCCAAGAGAAGCATCGGCATGAGAAGCACCGTCACGAGAAGCATCATCATGATAAGCATCGCCGCGATGAGCAT
CACCACGATAATCTTCGCTCACGCTCCCATCCTGACTCTCATCACCGCGATACATCACGCAGAGAAAAGCAGCAT
CAGCGCTCTGGGGATTCAGAAAAGCGACGAGCTCGCACCAGCCTCGCAGAATCGGTGCCCGGTCTCTTCGTAATT
GACAAGAAAGGCGATCCCCTCATCAGAAAATACGGTTTAGACCGCTACAGGATACCCTCTTACTCTCGCTACGGT
GGCAACAGAGTGCTGGGAACAGATGGACGCCTCGTCATCCACAGAGACGGACCGGTGCAAAAATTCAGCCTCTTG
TTTCCTGGGCAACGACTATCCGACCTCCTCGGTGAGCGGTCGTCAAGCAGCCGCGACGTAGGCGGATTGCGATCC
CGAGATTGGATACAGCGCAAGGCCGTGAGACTTCGCCCTCGACGGGATAGGATTGTCGACAACGACGAAGAAGAG
GGCTATTTGCGTCTGGAGAGTCCGCGGAAGCGCCGGCGACACCATCGTCACAGCGGATCATCTGATGGAGAAGAC
GCGACGCCTTGGAGATGGATAGAGACCAAGGCTAAAGCAGATGACGAGGAGGAGGAGGAGGAGGAGGAGGAGGAG
GAGGCGTCGAGCGAATCTGACGTGGAAGAAGGCGACGATCCTTTGCGATGGAAATCCAGCCAGCTTCACAGGCGT
GTCAAAGATCATCCGGACGATATAGCCGGCTGGCTCGAGTTGGTCGCTCACCAGGATATTATCCTATCTGGCGAC
AACAAGGGTGACAATGACGTTTCTGAAAACGCGGCTCGCAGCATCTCCGAGGTCAAGGTTCACCTACTCGAGTCA
GCGCTGTCACACGCGTCACGACCATCAGATCGCGAGACGGTTCTGGCTGCCCTCATGCGCGAAGGCGTCAAGATT
TGGAGCCGGAAAGTGGCCGACAAGAAGTGGGCGCAAGTCTCGGACGACGAGCATGGTAGTTTCGAGCTGTGGAAG
GCTCATGTTGACTATGCCATGTCGAGCATCACCACGGTTCAGTACGAGGCTGTCAAGACGATGATGATGGAGCGT
CTTCATCAAGCCTGCTCGCGAGCCCTTCCGTCGTATTCATACGAAGCCATCTACGTCTTCCTCAGGGCGACTAGA
TTCATCCACGATGCCGGCTACAAGGAGCTCGCCGTGGCGGCATGGCAAGGTCTTTTGGAGCTCAACCTGTTTAGA
CCGGAGGGCATCGATAACCAGACCGAGGCGCTGGCCATCTTTCGAGACTTCTGGGAGAGCGAGGTGCCTAGGCTG
GGCGAAGAGGGAGCGCAGGGCTGGAGGCAGTACGTTCAGAACGGCGGAGTGGGTGACGCTCCCGATCCTGTCAAC
AACGTCGAGCCCGTGGATGCGCCTCAGCAGGATCCTTACGATGCCTGGGGAGCGGCTGAAGGCCTCTGCGGGAAG
AGAGCTTCCATGCCGGCGAGGACGATGGATGGCGGCACGGACGAAGACCCGTTTAGAGTCGTCATGTACTCTGAC
ATCGAGCCGCTGATGTTTCTCCTTCCCCAGAGTGAGCTGGAGGAAGCCACTGGCGAGCTTGTCGACGCCTATCTC
CTCTTCTGCGGACTTTCACCCGCGTTTCGAGGCGGCGTGGCCATCGAGAAGGCGAGGCACGACCAGTTCGTGGTG
CGAAGCTGTGGCAATATCCAGCTGCAGCCGATCTGGGAGGCCGAGGGAGGAGACGACAACACTTGGACCAGGAAA
CCGCCTTTGTTCGACGGGGGTTTCTGCCAATTGAACATGTCGGCTAGCCTCCTCTTCAGCGGCAGCGCTTGGTTC
CGCTATCTTAACGTGGCGGGTGAGGATCATGTGGTTGATCTCTCATGGGTACAGTCCACGCTGAAGCAGCTTGTC
TACTCGGCTGGTCTGTCGAGTCTGGCGGTATACTACCTGGGTCTATGCTTCGCCAGAGACGCAGGGTCTATCAGG
AAACACGCAAAGCCCCTGTTGAAGCGGTATCCGACGGACGTGTGTCTCTATAACGGCTACGCGCTGGCCGAGTTT
GCCAATGGAAACGCCGAGTTGGCCATCAAAGTACTGGCTTCCGCTGTCGAGTCTCAGGCGGTAAGACTGCATGAA
GTCGGCCCATGGTTTCGCAAACTAACCCGTACAGTTGGCCGCTCCCTCGACGGGGTACATCCTCTTCAAGACGTG
GAGCTGGATCGAGTTGCAGAGGGGCAACAAGGAGCTGGCCACGAGGCGTCTCTGTGCAGCCGTCGATGGATCACT
GCGGACGGACGAAGGCGTCGTCTCACCGTCGGTCTTGACTGAGGCGCGTGGCGAGTTTCGGTCGAGGTCGTCATG
GAGCCTGGACGAAGGATACTGGCAGGCGGCAACCAGCCACATCGAGTGCCTGGCACTGCTGGCCTATCTCACCGA
CGAGGGGGGCTCTGAGCCAGCGTCGAAGAGCCAAGGCAATATCTCGGCAGCCATCGAGGTCTTTGCGTCGGCTGT
GGATGGCGACGGCTTGGGTCCGTTTGCCAATGAACTCATGCTTCAGTGTGCCTCGAGGATGCTGTATTTCCACTC
GACCAAGGGGTACGTTACGGCTCTTCGCAGGGCCTGTCTCTGTTGCTGAAACGCCTTCGCCCCACAGACCTTTCC
GAAGAGCATTCATGCGGGAGCAGCTGGCGGGCTTCATCGACAAGTTCCCCCGAAACACCATGTTCATAAGCCTCT
TCGCATGGGCAGACACTGGCGTCGGAGTCAAGGACGAGACACGACGACTACTGGCAGACAAAGTGCTGACCAAGA
CGCACGACGCAGTCGGCAGCAGACTCTTCGCCGTCTCGCACGAGCTGACGCGCGGAAACGCCCAGCGCACGCGGG
CAGCCCTCCAGCAAGCCGTCTCCAGCGAGGCGTGCAGACGGAGCACGACGCTGTGGCTGCGGTACGTGCGCTTCT
GCCGGTCGCAGGCGTCGCTGCGTGCTGGGGCGAGCGAGGTGCTTTACAGGGCGCTGGGGAGCTGTCCTTGGTCCA
AGGAGTTGATGATGGAGGCCTTTTCGTCGGGGTTGGGAGGGGGGAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail