Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04438
Gene name
Locationscaffold_04:3245557..3245862
Strand+
Gene length (bp)305
Transcript length (bp)237
Coding sequence length (bp)237
Protein length (aa) 79

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08583 Cmc1 Cytochrome c oxidase biogenesis protein Cmc1 like 1.8E-16 1 70

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4748 0.2445 0.0684 0.0297 0.5931 0.0051 0.1259 0.053 0.0258 0.0212

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6284
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4475
Ophiocordyceps australis map64 (Brazil) OphauB2|3964
Ophiocordyceps camponoti-floridani Ophcf2|04438 (this protein)
Ophiocordyceps kimflemingae Ophio5|4650
Ophiocordyceps subramaniannii Hirsu2|8412

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04438
MHPHLHNKNALACEDIIAALEACHAQGFMHKVTGGCNEVKTQVNKCLREERARLQADNRAAAKAKRKQLEEERKN
LGL*
Coding >Ophcf2|04438
ATGCATCCCCACCTCCACAACAAGAACGCTCTAGCTTGCGAGGACATCATCGCCGCCCTCGAGGCATGCCACGCC
CAAGGCTTCATGCACAAGGTCACCGGCGGCTGCAACGAAGTCAAGACCCAGGTCAACAAGTGTCTACGTGAGGAG
CGAGCAAGGTTACAGGCAGATAACAGGGCCGCCGCCAAGGCGAAGCGCAAGCAGTTGGAGGAGGAACGGAAGAAC
CTGGGTCTCTGA
Transcript >Ophcf2|04438
ATGCATCCCCACCTCCACAACAAGAACGCTCTAGCTTGCGAGGACATCATCGCCGCCCTCGAGGCATGCCACGCC
CAAGGCTTCATGCACAAGGTCACCGGCGGCTGCAACGAAGTCAAGACCCAGGTCAACAAGTGTCTACGTGAGGAG
CGAGCAAGGTTACAGGCAGATAACAGGGCCGCCGCCAAGGCGAAGCGCAAGCAGTTGGAGGAGGAACGGAAGAAC
CTGGGTCTCTGA
Gene >Ophcf2|04438
ATGCATCCCCACCTCCACAACAAGAACGCTCTAGGTGAAATACTCTTCTACCACCATTAGCTAACCTCCAAAACC
CGCAACTGACCCGACTTGGCCGCCCAGCTTGCGAGGACATCATCGCCGCCCTCGAGGCATGCCACGCCCAAGGCT
TCATGCACAAGGTCACCGGCGGCTGCAACGAAGTCAAGACCCAGGTCAACAAGTGTCTACGTGAGGAGCGAGCAA
GGTTACAGGCAGATAACAGGGCCGCCGCCAAGGCGAAGCGCAAGCAGTTGGAGGAGGAACGGAAGAACCTGGGTC
TCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail