Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04429
Gene name
Locationscaffold_04:3225857..3228005
Strand-
Gene length (bp)2148
Transcript length (bp)1980
Coding sequence length (bp)1980
Protein length (aa) 660

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09402 MSC Man1-Src1p-C-terminal domain 2.2E-95 296 615
PF12949 HeH HeH/LEM domain 4.7E-15 14 48

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.0848 0.5279 0.0433 0.0383 0.188 0.0713 0.5396 0.0908 0.4883 0.0315

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup602
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3869
Ophiocordyceps australis map64 (Brazil) OphauB2|2941
Ophiocordyceps australis map64 (Brazil) OphauB2|2942
Ophiocordyceps camponoti-floridani Ophcf2|04429 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4848
Ophiocordyceps kimflemingae Ophio5|5088
Ophiocordyceps subramaniannii Hirsu2|8145
Ophiocordyceps subramaniannii Hirsu2|8146

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04429
MVEGEDYLQEGFDPRSVTMPRLRSILVTHSIDFPSTAKKAQLVELVTDRVLPQVPRLRSERAKAKRSSFGIVNAG
SADDTNTWDDTEMQPPRTASKRSRSPVKSSTRRKTIEPEVEPPLVKSSRKSSSRSASRPPDDDDATAGTKSKRRI
RRTITPQIKAESDEERPRLDELQAVKSEEESVFTDDNPFQSGSSPPATKSANQRRRTAGDELFKDIVRPSGRRSE
ATSRKSSAMAMPPFQPEAVDEPLEPGEEFTPNEQLELERAERAGEISIAPRKPRQETGRRTSFRTPLLALMMALL
SAYGAWYRQEKMAVGYCGLGRPAKTMLPPEVPVPNFLQPFVEVQCEPCPLHAYCYQDYSVRCEPDFILQPHPLSL
GGLVPLPPSCEPDGEKARRVQAVADKAVEELRERRAKFECGTPADDEGGQQHKSPAMSEDELKESVGKKRSKRLS
QVEFDELWKAAIGEVTARDEVSIEKEAESVEMEADPPIPHFFLASNLRLPHTLDFPSPLLAQTVFYLRSKYRRHR
AASAQVPGLVDAVLGRLADQKELGDEDLDDSWLFLPNLRDDVLRNVHSLSERESIWRRVRRVVEQNSNVRTGQRE
GRSGEVGRAWEWIGPVKGEGARRRRSGRVSWAPESAPETPENVREMVETKRWDEPRPYY*
Coding >Ophcf2|04429
ATGGTTGAAGGCGAGGATTATCTCCAAGAGGGCTTTGACCCTCGCAGCGTGACCATGCCGCGTTTGCGCTCCATC
CTCGTCACCCACAGCATCGACTTCCCCTCCACGGCCAAGAAGGCGCAGCTCGTGGAACTCGTGACGGATCGCGTC
CTACCGCAGGTTCCGCGGCTTCGTTCTGAGCGGGCCAAGGCTAAGCGATCCAGCTTTGGCATCGTCAATGCCGGA
AGCGCGGATGATACCAATACGTGGGATGATACTGAGATGCAGCCGCCGCGGACTGCGTCGAAACGATCTAGATCG
CCCGTCAAGAGCTCGACGAGGAGAAAGACGATTGAGCCTGAGGTTGAACCTCCTTTGGTCAAGTCTTCGCGGAAG
AGCAGCTCGCGATCTGCAAGTCGGCCTCCTGACGACGATGATGCGACGGCGGGAACAAAGTCGAAGCGAAGAATC
CGGAGGACGATTACGCCGCAGATCAAGGCTGAATCTGATGAGGAGAGGCCGCGGTTGGATGAGCTTCAGGCTGTC
AAGTCGGAGGAGGAGAGCGTCTTTACCGATGATAATCCCTTCCAGAGCGGCAGTTCTCCGCCTGCGACCAAGTCG
GCGAATCAACGGCGGCGGACGGCGGGCGATGAGCTTTTCAAGGATATCGTTCGGCCTTCTGGTCGTCGGTCTGAG
GCTACGAGCAGGAAGTCATCGGCGATGGCCATGCCGCCTTTCCAGCCGGAAGCTGTCGATGAACCCCTCGAGCCG
GGAGAAGAGTTTACGCCCAACGAGCAGCTCGAGTTGGAGAGAGCCGAAAGAGCAGGCGAGATATCGATCGCGCCT
CGGAAACCTCGGCAAGAAACGGGCCGCCGGACGAGCTTCAGGACGCCGCTGCTCGCTCTCATGATGGCGTTGCTC
TCGGCTTATGGAGCCTGGTATCGACAGGAGAAGATGGCTGTCGGCTACTGCGGTCTCGGACGTCCGGCAAAGACC
ATGTTGCCGCCCGAAGTCCCGGTGCCCAACTTCCTGCAACCGTTTGTGGAGGTGCAGTGCGAGCCCTGCCCGCTA
CACGCCTACTGCTACCAGGACTACTCCGTCCGCTGCGAGCCCGACTTTATCCTGCAGCCACATCCCCTATCGCTG
GGCGGCCTCGTTCCCCTGCCCCCCTCATGCGAACCCGACGGCGAAAAGGCGCGTCGCGTTCAGGCCGTGGCCGAC
AAGGCTGTCGAGGAACTGCGAGAGCGACGCGCCAAGTTCGAGTGCGGCACGCCGGCGGACGATGAGGGCGGACAG
CAGCACAAGTCTCCCGCCATGAGCGAGGACGAGCTCAAGGAGAGCGTCGGGAAGAAACGGAGCAAGAGGCTCAGC
CAGGTCGAGTTTGACGAGTTGTGGAAGGCTGCCATCGGGGAGGTTACGGCTCGAGACGAGGTCTCTATCGAGAAA
GAAGCAGAATCGGTTGAAATGGAAGCAGATCCGCCGATTCCTCACTTCTTCCTCGCGTCAAACTTGCGTCTTCCT
CACACGCTCGACTTCCCCTCGCCCTTGCTCGCCCAGACAGTCTTCTACCTGCGGTCCAAGTACCGACGTCACCGT
GCCGCGTCGGCCCAAGTCCCGGGCCTCGTCGACGCTGTTCTCGGCAGGCTCGCTGATCAGAAGGAGCTGGGGGAT
GAGGACCTCGACGACAGCTGGCTCTTCCTGCCGAATTTGCGGGACGATGTGCTGAGGAATGTGCATTCGCTTTCT
GAGCGGGAGAGCATCTGGCGTCGTGTCAGGCGTGTTGTTGAGCAGAACAGCAACGTGCGGACTGGCCAGCGGGAG
GGCCGCAGCGGGGAAGTTGGCCGCGCGTGGGAATGGATCGGGCCCGTCAAGGGGGAGGGTGCCAGGAGGCGGCGC
AGCGGGAGGGTTTCGTGGGCTCCGGAGTCGGCGCCCGAGACGCCCGAGAATGTGCGGGAGATGGTTGAGACCAAG
AGATGGGATGAGCCGAGGCCTTACTATTGA
Transcript >Ophcf2|04429
ATGGTTGAAGGCGAGGATTATCTCCAAGAGGGCTTTGACCCTCGCAGCGTGACCATGCCGCGTTTGCGCTCCATC
CTCGTCACCCACAGCATCGACTTCCCCTCCACGGCCAAGAAGGCGCAGCTCGTGGAACTCGTGACGGATCGCGTC
CTACCGCAGGTTCCGCGGCTTCGTTCTGAGCGGGCCAAGGCTAAGCGATCCAGCTTTGGCATCGTCAATGCCGGA
AGCGCGGATGATACCAATACGTGGGATGATACTGAGATGCAGCCGCCGCGGACTGCGTCGAAACGATCTAGATCG
CCCGTCAAGAGCTCGACGAGGAGAAAGACGATTGAGCCTGAGGTTGAACCTCCTTTGGTCAAGTCTTCGCGGAAG
AGCAGCTCGCGATCTGCAAGTCGGCCTCCTGACGACGATGATGCGACGGCGGGAACAAAGTCGAAGCGAAGAATC
CGGAGGACGATTACGCCGCAGATCAAGGCTGAATCTGATGAGGAGAGGCCGCGGTTGGATGAGCTTCAGGCTGTC
AAGTCGGAGGAGGAGAGCGTCTTTACCGATGATAATCCCTTCCAGAGCGGCAGTTCTCCGCCTGCGACCAAGTCG
GCGAATCAACGGCGGCGGACGGCGGGCGATGAGCTTTTCAAGGATATCGTTCGGCCTTCTGGTCGTCGGTCTGAG
GCTACGAGCAGGAAGTCATCGGCGATGGCCATGCCGCCTTTCCAGCCGGAAGCTGTCGATGAACCCCTCGAGCCG
GGAGAAGAGTTTACGCCCAACGAGCAGCTCGAGTTGGAGAGAGCCGAAAGAGCAGGCGAGATATCGATCGCGCCT
CGGAAACCTCGGCAAGAAACGGGCCGCCGGACGAGCTTCAGGACGCCGCTGCTCGCTCTCATGATGGCGTTGCTC
TCGGCTTATGGAGCCTGGTATCGACAGGAGAAGATGGCTGTCGGCTACTGCGGTCTCGGACGTCCGGCAAAGACC
ATGTTGCCGCCCGAAGTCCCGGTGCCCAACTTCCTGCAACCGTTTGTGGAGGTGCAGTGCGAGCCCTGCCCGCTA
CACGCCTACTGCTACCAGGACTACTCCGTCCGCTGCGAGCCCGACTTTATCCTGCAGCCACATCCCCTATCGCTG
GGCGGCCTCGTTCCCCTGCCCCCCTCATGCGAACCCGACGGCGAAAAGGCGCGTCGCGTTCAGGCCGTGGCCGAC
AAGGCTGTCGAGGAACTGCGAGAGCGACGCGCCAAGTTCGAGTGCGGCACGCCGGCGGACGATGAGGGCGGACAG
CAGCACAAGTCTCCCGCCATGAGCGAGGACGAGCTCAAGGAGAGCGTCGGGAAGAAACGGAGCAAGAGGCTCAGC
CAGGTCGAGTTTGACGAGTTGTGGAAGGCTGCCATCGGGGAGGTTACGGCTCGAGACGAGGTCTCTATCGAGAAA
GAAGCAGAATCGGTTGAAATGGAAGCAGATCCGCCGATTCCTCACTTCTTCCTCGCGTCAAACTTGCGTCTTCCT
CACACGCTCGACTTCCCCTCGCCCTTGCTCGCCCAGACAGTCTTCTACCTGCGGTCCAAGTACCGACGTCACCGT
GCCGCGTCGGCCCAAGTCCCGGGCCTCGTCGACGCTGTTCTCGGCAGGCTCGCTGATCAGAAGGAGCTGGGGGAT
GAGGACCTCGACGACAGCTGGCTCTTCCTGCCGAATTTGCGGGACGATGTGCTGAGGAATGTGCATTCGCTTTCT
GAGCGGGAGAGCATCTGGCGTCGTGTCAGGCGTGTTGTTGAGCAGAACAGCAACGTGCGGACTGGCCAGCGGGAG
GGCCGCAGCGGGGAAGTTGGCCGCGCGTGGGAATGGATCGGGCCCGTCAAGGGGGAGGGTGCCAGGAGGCGGCGC
AGCGGGAGGGTTTCGTGGGCTCCGGAGTCGGCGCCCGAGACGCCCGAGAATGTGCGGGAGATGGTTGAGACCAAG
AGATGGGATGAGCCGAGGCCTTACTATTGA
Gene >Ophcf2|04429
ATGGTTGAAGGCGAGGATTATCTCCAAGAGGGCTTTGACCCTCGCAGCGTGACCATGCCGCGTTTGCGCTCCATC
CTCGTCACCCACAGCATCGACTTCCCCTCCACGGCCAAGAAGGCGCAGCTCGTGGAACTCGTGACGGATCGCGTC
CTACCGCAGGTTCCGCGGCTTCGTTCTGAGCGGGCCAAGGCTAAGCGATCCAGCTTTGGCATCGTCAATGCCGGA
AGCGCGGATGATACCAATACGTGGGATGATACTGAGATGCAGCCGCCGCGGACTGCGTCGAAACGATCTAGATCG
CCCGTCAAGAGCTCGACGAGGAGAAAGACGATTGAGCCTGAGGTTGAACCTCCTTTGGTCAAGTCTTCGCGGAAG
AGCAGCTCGCGATCTGCAAGTCGGCCTCCTGACGACGATGATGCGACGGCGGGAACAAAGTCGAAGCGAAGAATC
CGGAGGACGATTACGCCGCAGATCAAGGCTGAATCTGATGAGGAGAGGCCGCGGTTGGATGAGCTTCAGGCTGTC
AAGTCGGAGGAGGAGAGCGTCTTTACCGATGATAATCCCTTCCAGAGCGGCAGTTCTCCGCCTGCGACCAAGTCG
GCGAATCAACGGCGGCGGACGGCGGGCGATGAGCTTTTCAAGGATATCGTTCGGCCTTCTGGTCGTCGGTCTGAG
GCTACGAGCAGGAAGTCATCGGCGATGGCCATGCCGCCTTTCCAGCCGGAAGCTGTCGATGAACCCCTCGAGCCG
GGAGAAGAGTTTACGCCCAACGAGCAGCTCGAGTTGGAGAGAGCCGAAAGAGCAGGCGAGATATCGATCGCGCCT
CGGAAACCTCGGCAAGAAACGGGCCGCCGGACGAGCTTCAGGACGCCGCTGCTCGCTCTCATGATGGCGTTGCTC
TCGGCTTATGGAGCCTGGTATCGACAGGAGAAGATGGCTGTCGGCTACTGCGGTCTCGGACGTCCGGCAAAGACC
ATGTTGCCGCCCGAAGTCCCGGTGCCCAACTTCCTGCAACCGTTTGTGGAGGTGCAGTGCGAGCCCTGCCCGCTA
CACGCCTACTGCTACCAGGACTACTCCGTCCGCTGCGAGCCCGACTTTATCCTGCAGCCACATCCCCTATCGCTG
GGCGGCCTCGTTCCCCTGCCCCCCTCATGCGAACCCGACGGCGAAAAGGCGCGTCGCGTTCAGGCCGTGGCCGAC
AAGGCTGTCGAGGAACTGCGAGAGCGACGCGCCAAGTTCGAGTGCGGCACGCCGGCGGACGATGAGGGCGGACAG
CAGCACAAGTCTCCCGCCATGAGCGAGGACGAGCTCAAGGAGAGCGTCGGGAAGAAACGGAGCAAGAGGCTCAGC
CAGGTCGAGTTTGACGAGTTGTGGAAGGCTGCCATCGGGGAGGTTACGGCTCGAGACGAGGTCTCTATCGAGAAA
GAAGCAGAGTGCGTTCCCTCCCTCCCCCTTTGATGTGAACCGCCTGACGGTGGGCTTTGCGAAATCCCACCCTCG
GATGGCCATCTCTTTTCTGACTCACCGACTAATCAGATCGGTTGAAATGGAAGCAGATCCGCCGATTCCTCACTT
CTTCCTCGCGTCAAACTTGCGTCTTCCTCACACGCTCGACTTCCCCTCGCGTGTGCGGTCCGACGATCCCTCTGG
CACGCAGTGGCAAGATATCGACTCCCTCTTGGTCTCCTAGCCTTGCTCGCCCAGACAGTCTTCTACCTGCGGTCC
AAGTACCGACGTCACCGTGCCGCGTCGGCCCAAGTCCCGGGCCTCGTCGACGCTGTTCTCGGCAGGCTCGCTGAT
CAGAAGGAGCTGGGGGATGAGGACCTCGACGACAGCTGGCTCTTCCTGCCGAATTTGCGGGACGATGTGCTGAGG
AATGTGCATTCGCTTTCTGAGCGGGAGAGCATCTGGCGTCGTGTCAGGCGTGTTGTTGAGCAGAACAGCAACGTG
CGGACTGGCCAGCGGGAGGGCCGCAGCGGGGAAGTTGGCCGCGCGTGGGAATGGATCGGGCCCGTCAAGGGGGAG
GGTGCCAGGAGGCGGCGCAGCGGGAGGGTTTCGTGGGCTCCGGAGTCGGCGCCCGAGACGCCCGAGAATGTGCGG
GAGATGGTTGAGACCAAGAGATGGGATGAGCCGAGGCCTTACTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail