Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04424
Gene name
Locationscaffold_04:3214301..3215711
Strand-
Gene length (bp)1410
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07970 COPIIcoated_ERV Endoplasmic reticulum vesicle transporter 5.1E-89 141 410
PF13850 ERGIC_N Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) 2.7E-29 7 96

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 387 409 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 252.71 130.28 375.14
Alive In ants, during behavior modification 131.09 73.14 189.04
Dead In ants, recently dead 69.33 39.35 99.31

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.001043 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04424
MPAKSRFTRLDAFTKTVDEARIRTTSGGVVTIVSLLVVLFLSWGEWAEYRRVVIRPELVVDKGRGERMEIHLNFT
FPKMPCELLTLDVMDVSGEQQHGVAHGVSKVRLQPQSQGGGVIDIKSLALHDEKADHLDPKYCGECYGASPPATA
KKSGCCNTCDEVREAYSAQGWAFGRGEGVEQCEREHYAEKLDAQREEGCRIEGALQVNKVVGNFHMAPGRSFSNG
NIHVHDLKNYWDTPDGKKHDFTHTIHQLRFGPQLPDDVKKRLGGSGAMPWTNHHLNPLDGSQHDTTDSNLNYMYF
VKIVPTSYLPLGWEKKMQRLSGTLDGDGSVETHQYSVTSHKRSLSGGNDAAEGHAERQHSKGGIPGVFFSYDISP
MKVVNREEQSKSFLGFLAGLCAIVGGTLTVAAAVDRGLFEGATRLKKMRSKDL*
Coding >Ophcf2|04424
ATGCCGGCCAAGTCACGCTTCACCAGGCTCGATGCCTTTACGAAGACGGTCGACGAGGCTCGTATCCGGACAACG
AGCGGTGGCGTCGTCACCATCGTTTCGCTGCTTGTCGTCTTGTTTCTATCGTGGGGAGAATGGGCCGAGTATCGT
CGGGTGGTGATACGCCCCGAGCTGGTGGTGGACAAGGGCAGAGGCGAGCGCATGGAGATACACCTCAACTTTACC
TTTCCCAAGATGCCTTGTGAGCTGCTCACGCTGGATGTCATGGACGTCTCGGGCGAACAGCAGCATGGCGTCGCC
CACGGCGTCAGCAAGGTCCGGCTGCAGCCTCAGTCTCAGGGCGGTGGCGTCATCGACATCAAGTCGCTGGCTCTT
CATGACGAAAAGGCCGATCACTTGGATCCCAAGTACTGCGGCGAGTGTTACGGAGCCTCGCCCCCCGCCACGGCC
AAGAAGTCGGGCTGCTGCAACACGTGCGACGAGGTTCGCGAGGCCTACTCCGCTCAGGGATGGGCCTTTGGGAGG
GGAGAGGGCGTCGAGCAGTGCGAGCGCGAGCACTATGCCGAGAAGCTCGATGCGCAGAGAGAGGAGGGCTGTCGT
ATCGAGGGAGCTTTGCAGGTCAACAAGGTGGTTGGGAACTTTCACATGGCTCCTGGACGCAGTTTCAGCAACGGA
AATATTCACGTTCACGACCTCAAGAACTACTGGGATACGCCCGACGGGAAGAAGCACGACTTTACACACACCATT
CATCAGCTGCGTTTCGGCCCTCAGCTGCCGGACGACGTCAAGAAGAGGCTGGGCGGCTCCGGGGCTATGCCGTGG
ACGAATCATCACCTCAATCCGCTGGATGGGTCTCAGCACGACACGACTGATTCGAACCTCAACTACATGTACTTT
GTCAAGATCGTCCCGACGTCGTATCTGCCTCTCGGATGGGAGAAGAAGATGCAGCGGCTCTCGGGAACCCTGGAC
GGCGATGGCAGCGTCGAGACGCACCAGTACTCCGTCACCAGTCACAAGCGAAGTCTCAGCGGCGGGAACGATGCG
GCAGAGGGCCATGCTGAGCGTCAACACTCCAAGGGCGGCATCCCGGGCGTCTTCTTCTCCTACGACATCTCGCCG
ATGAAGGTTGTCAACCGCGAGGAGCAGTCCAAGTCGTTCCTCGGCTTCCTCGCGGGTCTCTGTGCCATCGTGGGC
GGCACCTTGACAGTGGCGGCTGCCGTCGACAGGGGGCTGTTCGAGGGCGCGACGCGGCTGAAGAAGATGCGGTCC
AAGGACCTGTGA
Transcript >Ophcf2|04424
ATGCCGGCCAAGTCACGCTTCACCAGGCTCGATGCCTTTACGAAGACGGTCGACGAGGCTCGTATCCGGACAACG
AGCGGTGGCGTCGTCACCATCGTTTCGCTGCTTGTCGTCTTGTTTCTATCGTGGGGAGAATGGGCCGAGTATCGT
CGGGTGGTGATACGCCCCGAGCTGGTGGTGGACAAGGGCAGAGGCGAGCGCATGGAGATACACCTCAACTTTACC
TTTCCCAAGATGCCTTGTGAGCTGCTCACGCTGGATGTCATGGACGTCTCGGGCGAACAGCAGCATGGCGTCGCC
CACGGCGTCAGCAAGGTCCGGCTGCAGCCTCAGTCTCAGGGCGGTGGCGTCATCGACATCAAGTCGCTGGCTCTT
CATGACGAAAAGGCCGATCACTTGGATCCCAAGTACTGCGGCGAGTGTTACGGAGCCTCGCCCCCCGCCACGGCC
AAGAAGTCGGGCTGCTGCAACACGTGCGACGAGGTTCGCGAGGCCTACTCCGCTCAGGGATGGGCCTTTGGGAGG
GGAGAGGGCGTCGAGCAGTGCGAGCGCGAGCACTATGCCGAGAAGCTCGATGCGCAGAGAGAGGAGGGCTGTCGT
ATCGAGGGAGCTTTGCAGGTCAACAAGGTGGTTGGGAACTTTCACATGGCTCCTGGACGCAGTTTCAGCAACGGA
AATATTCACGTTCACGACCTCAAGAACTACTGGGATACGCCCGACGGGAAGAAGCACGACTTTACACACACCATT
CATCAGCTGCGTTTCGGCCCTCAGCTGCCGGACGACGTCAAGAAGAGGCTGGGCGGCTCCGGGGCTATGCCGTGG
ACGAATCATCACCTCAATCCGCTGGATGGGTCTCAGCACGACACGACTGATTCGAACCTCAACTACATGTACTTT
GTCAAGATCGTCCCGACGTCGTATCTGCCTCTCGGATGGGAGAAGAAGATGCAGCGGCTCTCGGGAACCCTGGAC
GGCGATGGCAGCGTCGAGACGCACCAGTACTCCGTCACCAGTCACAAGCGAAGTCTCAGCGGCGGGAACGATGCG
GCAGAGGGCCATGCTGAGCGTCAACACTCCAAGGGCGGCATCCCGGGCGTCTTCTTCTCCTACGACATCTCGCCG
ATGAAGGTTGTCAACCGCGAGGAGCAGTCCAAGTCGTTCCTCGGCTTCCTCGCGGGTCTCTGTGCCATCGTGGGC
GGCACCTTGACAGTGGCGGCTGCCGTCGACAGGGGGCTGTTCGAGGGCGCGACGCGGCTGAAGAAGATGCGGTCC
AAGGACCTGTGA
Gene >Ophcf2|04424
ATGCCGGCCAAGTCACGCTTCACCAGGCTCGATGCCTTTACGAAGACGGTCGACGAGGCTCGTATCCGGACAACG
AGCGGTGGCGTCGTCACCATCGTTTCGCTGCTTGTCGTCTTGTTTCTATCGTGGGGAGAATGGGCCGAGTATCGT
CGGGTGGTGATACGCCCCGAGCTGGTGGTGGACAAGGGCAGAGGCGAGTCGCAATCGCTGGCTTGTCGTCTTGCG
GCGTGGCTGACCCTCTTCTTCGATACCTAGGCGAGCGCATGGAGATACACCTCAACTTTACCTTTCCCAAGATGC
CTTGTGAGCTGCTCACGCTGGATGTCATGGACGTCTCGGGCGAACAGCAGCATGGCGTCGCCCACGGCGTCAGCA
AGGTCCGGCTGCAGCCTCAGTCTCAGGGCGGTGGCGTCATCGACATCAAGTCGCTGGCTCTTCATGACGAAAAGG
CCGATCACTTGGATCCCAAGTACTGCGGCGAGTGTTACGGAGCCTCGCCCCCCGCCACGGCCAAGAAGTCGGGCT
GCTGCAACACGTGCGACGAGGTTCGCGAGGCCTACTCCGCTCAGGGATGGGCCTTTGGGAGGGGAGAGGGCGTCG
AGCAGTGCGAGCGCGAGCACTATGCCGAGAAGCTCGATGCGCAGAGAGAGGAGGGCTGTCGTATCGAGGGAGCTT
TGCAGGTCAACAAGGTGGTTGGGAACTTTCACATGGCTCCTGGACGCAGTTTCAGCAACGGAAATATTCACGTTC
ACGACCTCAAGAACTACTGGGATACGCCCGACGGGAAGAAGCACGACTTTACACACACCATTCATCAGCTGCGTT
TCGGCCCTCAGCTGCCGGACGACGTCAAGAAGAGGCTGGGCGGCTCCGGGGCTATGCCGTGGACGAATCATCACC
TCAATCCGCTGGATGGGTCTCAGCACGACACGACTGATTCGAACCTCAACTACATGTACTTTGTCAAGATCGTCC
CGACGTCGTATCTGCCTCTCGGATGGGAGAAGAAGATGCAGCGGCTCTCGGGAACCCTGGACGGCGATGGCAGCG
TCGAGACGCACCAGTACTCCGTCACCAGTCACAAGCGAAGTCTCAGCGGCGGGAACGATGCGGCAGAGGGCCATG
CTGAGCGTCAACACTCCAAGGGCGGCATCCCGGGCGTCTTCTTCTCCTACGTAAGTCCCCTTCTTTGCATAATCC
TCCCATCTCATGGTGTTGCTGACAGCCGGGCACAAGGACATCTCGCCGATGAAGGTTGTCAACCGCGAGGAGCAG
TCCAAGTCGTTCCTCGGCTTCCTCGCGGGTCTCTGTGCCATCGTGGGCGGCACCTTGACAGTGGCGGCTGCCGTC
GACAGGGGGCTGTTCGAGGGCGCGACGCGGCTGAAGAAGATGCGGTCCAAGGACCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail