Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04411
Gene name
Locationscaffold_04:3182215..3185390
Strand+
Gene length (bp)3175
Transcript length (bp)3000
Coding sequence length (bp)3000
Protein length (aa) 1000

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 1.5E-47 122 326
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 3.4E-47 773 976
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.1E-19 344 704
PF13246 Cation_ATPase Cation transport ATPase (P-type) 8.4E-21 414 516
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 4.7E-19 7 72
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 3.2E-06 684 729

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 61 78 17
2 83 105 22
3 258 277 19
4 297 319 22
5 749 771 22
6 781 800 19
7 821 843 22
8 920 942 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 286.20 123.81 448.58
Alive In ants, during behavior modification 78.42 39.36 117.48
Dead In ants, recently dead 54.89 30.45 79.32

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.039278 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04411
MDNAFARPITAVLAEFQVDEHKGLSDSQVRQLRNKHGRNAIPEEPPTPIWELILEQFKDQLVIILLGSAAVSFVL
ALFEDQGGWSAFVDPIVILTILVLNAVVGVSQESSAEKAIAALQEYSANESNVIRNGGHIARLKAEELVPGDIVT
VAVGDRIPADCRLVSIESNSFAVDQAILTGESESVGKEQLVVKDERAVLQDQVNMLFSGTTVVIGRAKAVVVLTG
PNTAIGDIHESITAQISEPTPLKQKLNDFGDSLAKVITLICILVWLINIPNFNDPSHGTWAKGAIYYLKIAVSLG
VAAIPEGLAVVITTCLALGTRKMAAKNAVVRSLPSVETLGSCSVICSDKTGTLTTNQMSVSKVVYLDEQGSDLVE
LDVEGTTFAPTGAVCMAGQAVDDLPSKSDTIRQMAEVAALCNDSYLAYDSRTATFSTVGEPTEGALRVLVEKLGP
RPPTGTHPDDCVHYASAKHEKQLPRLATYEFSRDRKSMSVLVKSGKQQKKLLVKGAPESILERCTHALVGANGKR
VALNNKLSELVLREVVEYGDRGLRIMALASIDDVSNNPRLSAKTTSQYAELEQNMTFLGLVGMLDPPRKEVPRSI
AQCKKAGIRIIVITGDNRYTAESICRQIGVFGPNEDLKGKSFTGREFENLSPGEQLKAAKRASLFSRVEPGHKSR
LVDLLQSLGEVVAMTGDGVNDAPALKKADIGVAMGSGTDVSKLAADMVLADSNFATIEVAIEEGRAIYSNTQQFI
RYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALSFNPPDNDIMKRQPRKRDEPLIGGWLFLR
YLIIGTYVGIATVAGYAWWFMYYAGGPQITFKQLSRFHHCSTEFPEIGCSMFSDQRARAGSTMSLSILVVIEMFN
AMNALSSSASLLTLPLWKNMMLVYAIALSMALHFALLYTPFLQSLFAILPLNREEWNAVLILSAPVILLDEVLKL
FERNYFMQTAPDVAMVARASKKKR*
Coding >Ophcf2|04411
ATGGACAACGCCTTCGCCCGTCCGATTACGGCGGTGCTCGCCGAGTTCCAAGTTGACGAGCACAAGGGCCTCAGC
GACTCTCAGGTTCGCCAGCTGCGCAACAAGCACGGCCGCAATGCCATTCCCGAGGAACCTCCGACGCCCATCTGG
GAGCTCATCTTGGAGCAGTTCAAGGACCAGCTCGTCATCATCCTTCTTGGTTCCGCTGCCGTATCCTTCGTCTTG
GCTCTGTTTGAGGACCAGGGCGGCTGGAGCGCCTTTGTCGACCCTATCGTGATCCTCACTATCCTCGTCCTCAAC
GCCGTCGTTGGAGTCTCCCAGGAAAGCAGCGCAGAAAAGGCTATTGCCGCTCTCCAGGAATATTCAGCAAACGAG
TCCAATGTCATCCGCAATGGAGGCCACATCGCCCGTCTCAAAGCCGAGGAGTTGGTACCCGGCGACATCGTCACG
GTGGCCGTCGGGGATCGCATCCCTGCCGACTGCCGCCTTGTTTCCATCGAGAGCAACAGCTTCGCCGTCGACCAG
GCCATCCTCACGGGCGAGAGCGAGAGCGTCGGCAAGGAACAGCTCGTCGTCAAGGATGAGCGTGCTGTGCTGCAG
GATCAGGTCAATATGCTCTTCTCCGGAACGACCGTCGTCATCGGCCGAGCCAAGGCTGTCGTTGTCTTGACCGGC
CCCAACACGGCCATCGGCGACATTCACGAGAGCATCACAGCCCAGATCTCGGAACCTACGCCGCTGAAGCAGAAG
CTCAACGATTTCGGTGACAGCCTCGCCAAGGTTATCACCCTCATCTGCATCCTCGTCTGGCTCATCAACATCCCC
AACTTCAACGACCCCAGCCACGGCACCTGGGCCAAAGGCGCCATCTACTATCTCAAGATTGCAGTCTCGCTGGGC
GTCGCCGCCATTCCTGAGGGTCTGGCAGTCGTCATCACCACCTGTCTGGCGCTTGGCACCCGCAAGATGGCGGCC
AAGAACGCCGTCGTCCGCAGCCTCCCCTCGGTCGAGACGCTCGGCAGCTGCAGCGTCATCTGCTCCGACAAGACG
GGCACGCTCACCACCAACCAGATGAGCGTCAGCAAAGTCGTCTATCTCGACGAGCAGGGCTCCGACCTCGTGGAG
CTCGACGTAGAGGGTACGACATTTGCGCCTACGGGCGCCGTCTGCATGGCAGGACAAGCCGTCGACGATCTGCCG
TCCAAGTCGGACACGATACGCCAGATGGCCGAGGTAGCCGCCTTGTGCAACGACTCCTACCTGGCCTACGACTCG
CGAACGGCCACCTTTTCGACAGTGGGCGAGCCCACCGAGGGCGCCCTCAGGGTTCTCGTCGAGAAGCTTGGGCCC
AGACCCCCTACCGGCACGCATCCCGACGACTGCGTCCATTATGCCAGCGCCAAGCACGAGAAGCAGCTCCCCAGG
CTGGCCACGTATGAGTTCTCGCGGGACCGAAAGAGCATGTCAGTCCTTGTCAAGAGCGGTAAGCAGCAGAAGAAG
CTGCTCGTCAAGGGAGCGCCCGAGTCCATCCTGGAGCGCTGCACCCATGCCCTCGTCGGCGCCAATGGCAAGCGA
GTCGCGCTCAACAACAAACTTTCGGAACTAGTGCTCCGAGAGGTGGTCGAATACGGGGACCGTGGCCTCCGTATC
ATGGCGCTGGCCAGCATCGACGACGTGTCCAATAACCCACGACTGTCGGCCAAGACGACAAGTCAGTACGCCGAG
CTCGAGCAGAACATGACGTTCCTGGGCCTGGTCGGCATGCTGGATCCTCCCCGCAAAGAGGTGCCCAGGTCGATT
GCGCAGTGCAAGAAGGCCGGCATCCGGATCATCGTCATCACGGGAGACAACCGCTACACGGCCGAGAGCATCTGC
CGGCAGATTGGCGTCTTTGGGCCCAACGAAGACCTCAAGGGCAAGAGCTTCACGGGCCGCGAGTTTGAAAACCTC
AGCCCGGGCGAGCAGCTCAAGGCGGCCAAGCGAGCCTCTCTCTTCTCCCGCGTAGAGCCAGGGCACAAGTCGCGG
CTCGTCGACCTCCTCCAATCGCTGGGTGAGGTGGTGGCCATGACGGGCGATGGCGTCAACGACGCTCCGGCGCTC
AAAAAGGCCGACATCGGCGTTGCCATGGGCTCTGGCACCGACGTTTCCAAGTTGGCGGCCGACATGGTGCTGGCC
GACAGCAACTTCGCCACCATCGAGGTGGCTATCGAGGAGGGCCGAGCCATCTACAGCAACACGCAGCAGTTCATC
CGCTACCTCATCTCGTCCAACATTGGCGAGGTTGTGTCCATCTTCCTGACGGCGGCTCTGGGCATGCCCGAGGCG
CTGATTCCGGTTCAGCTGCTCTGGGTCAACCTGGTGACGGATGGCTTGCCGGCCACGGCCCTCTCCTTCAACCCG
CCCGACAACGACATCATGAAGCGACAGCCGCGGAAGAGGGACGAGCCTCTGATCGGCGGCTGGCTGTTCCTGCGC
TACCTCATCATCGGTACTTACGTCGGCATCGCCACCGTGGCCGGCTACGCCTGGTGGTTCATGTACTACGCGGGA
GGCCCCCAGATCACCTTTAAGCAGCTGTCACGCTTCCACCACTGCTCGACCGAGTTTCCGGAGATTGGCTGTTCC
ATGTTCTCGGACCAGAGGGCGCGGGCGGGCTCGACCATGTCTTTGTCGATTCTGGTCGTGATTGAGATGTTCAAC
GCCATGAACGCCCTGTCGTCGAGCGCGTCGCTGCTCACTCTCCCACTGTGGAAGAACATGATGCTCGTGTACGCC
ATTGCCCTGTCGATGGCGCTGCACTTTGCACTGCTCTACACGCCCTTCCTCCAGAGCCTGTTTGCCATCCTCCCG
CTCAACCGCGAGGAGTGGAACGCGGTACTGATTCTCAGCGCTCCGGTCATTCTCCTGGACGAGGTGCTCAAGTTG
TTTGAACGCAACTATTTCATGCAGACGGCGCCGGACGTGGCCATGGTCGCCCGGGCAAGCAAGAAGAAGAGGTAG
Transcript >Ophcf2|04411
ATGGACAACGCCTTCGCCCGTCCGATTACGGCGGTGCTCGCCGAGTTCCAAGTTGACGAGCACAAGGGCCTCAGC
GACTCTCAGGTTCGCCAGCTGCGCAACAAGCACGGCCGCAATGCCATTCCCGAGGAACCTCCGACGCCCATCTGG
GAGCTCATCTTGGAGCAGTTCAAGGACCAGCTCGTCATCATCCTTCTTGGTTCCGCTGCCGTATCCTTCGTCTTG
GCTCTGTTTGAGGACCAGGGCGGCTGGAGCGCCTTTGTCGACCCTATCGTGATCCTCACTATCCTCGTCCTCAAC
GCCGTCGTTGGAGTCTCCCAGGAAAGCAGCGCAGAAAAGGCTATTGCCGCTCTCCAGGAATATTCAGCAAACGAG
TCCAATGTCATCCGCAATGGAGGCCACATCGCCCGTCTCAAAGCCGAGGAGTTGGTACCCGGCGACATCGTCACG
GTGGCCGTCGGGGATCGCATCCCTGCCGACTGCCGCCTTGTTTCCATCGAGAGCAACAGCTTCGCCGTCGACCAG
GCCATCCTCACGGGCGAGAGCGAGAGCGTCGGCAAGGAACAGCTCGTCGTCAAGGATGAGCGTGCTGTGCTGCAG
GATCAGGTCAATATGCTCTTCTCCGGAACGACCGTCGTCATCGGCCGAGCCAAGGCTGTCGTTGTCTTGACCGGC
CCCAACACGGCCATCGGCGACATTCACGAGAGCATCACAGCCCAGATCTCGGAACCTACGCCGCTGAAGCAGAAG
CTCAACGATTTCGGTGACAGCCTCGCCAAGGTTATCACCCTCATCTGCATCCTCGTCTGGCTCATCAACATCCCC
AACTTCAACGACCCCAGCCACGGCACCTGGGCCAAAGGCGCCATCTACTATCTCAAGATTGCAGTCTCGCTGGGC
GTCGCCGCCATTCCTGAGGGTCTGGCAGTCGTCATCACCACCTGTCTGGCGCTTGGCACCCGCAAGATGGCGGCC
AAGAACGCCGTCGTCCGCAGCCTCCCCTCGGTCGAGACGCTCGGCAGCTGCAGCGTCATCTGCTCCGACAAGACG
GGCACGCTCACCACCAACCAGATGAGCGTCAGCAAAGTCGTCTATCTCGACGAGCAGGGCTCCGACCTCGTGGAG
CTCGACGTAGAGGGTACGACATTTGCGCCTACGGGCGCCGTCTGCATGGCAGGACAAGCCGTCGACGATCTGCCG
TCCAAGTCGGACACGATACGCCAGATGGCCGAGGTAGCCGCCTTGTGCAACGACTCCTACCTGGCCTACGACTCG
CGAACGGCCACCTTTTCGACAGTGGGCGAGCCCACCGAGGGCGCCCTCAGGGTTCTCGTCGAGAAGCTTGGGCCC
AGACCCCCTACCGGCACGCATCCCGACGACTGCGTCCATTATGCCAGCGCCAAGCACGAGAAGCAGCTCCCCAGG
CTGGCCACGTATGAGTTCTCGCGGGACCGAAAGAGCATGTCAGTCCTTGTCAAGAGCGGTAAGCAGCAGAAGAAG
CTGCTCGTCAAGGGAGCGCCCGAGTCCATCCTGGAGCGCTGCACCCATGCCCTCGTCGGCGCCAATGGCAAGCGA
GTCGCGCTCAACAACAAACTTTCGGAACTAGTGCTCCGAGAGGTGGTCGAATACGGGGACCGTGGCCTCCGTATC
ATGGCGCTGGCCAGCATCGACGACGTGTCCAATAACCCACGACTGTCGGCCAAGACGACAAGTCAGTACGCCGAG
CTCGAGCAGAACATGACGTTCCTGGGCCTGGTCGGCATGCTGGATCCTCCCCGCAAAGAGGTGCCCAGGTCGATT
GCGCAGTGCAAGAAGGCCGGCATCCGGATCATCGTCATCACGGGAGACAACCGCTACACGGCCGAGAGCATCTGC
CGGCAGATTGGCGTCTTTGGGCCCAACGAAGACCTCAAGGGCAAGAGCTTCACGGGCCGCGAGTTTGAAAACCTC
AGCCCGGGCGAGCAGCTCAAGGCGGCCAAGCGAGCCTCTCTCTTCTCCCGCGTAGAGCCAGGGCACAAGTCGCGG
CTCGTCGACCTCCTCCAATCGCTGGGTGAGGTGGTGGCCATGACGGGCGATGGCGTCAACGACGCTCCGGCGCTC
AAAAAGGCCGACATCGGCGTTGCCATGGGCTCTGGCACCGACGTTTCCAAGTTGGCGGCCGACATGGTGCTGGCC
GACAGCAACTTCGCCACCATCGAGGTGGCTATCGAGGAGGGCCGAGCCATCTACAGCAACACGCAGCAGTTCATC
CGCTACCTCATCTCGTCCAACATTGGCGAGGTTGTGTCCATCTTCCTGACGGCGGCTCTGGGCATGCCCGAGGCG
CTGATTCCGGTTCAGCTGCTCTGGGTCAACCTGGTGACGGATGGCTTGCCGGCCACGGCCCTCTCCTTCAACCCG
CCCGACAACGACATCATGAAGCGACAGCCGCGGAAGAGGGACGAGCCTCTGATCGGCGGCTGGCTGTTCCTGCGC
TACCTCATCATCGGTACTTACGTCGGCATCGCCACCGTGGCCGGCTACGCCTGGTGGTTCATGTACTACGCGGGA
GGCCCCCAGATCACCTTTAAGCAGCTGTCACGCTTCCACCACTGCTCGACCGAGTTTCCGGAGATTGGCTGTTCC
ATGTTCTCGGACCAGAGGGCGCGGGCGGGCTCGACCATGTCTTTGTCGATTCTGGTCGTGATTGAGATGTTCAAC
GCCATGAACGCCCTGTCGTCGAGCGCGTCGCTGCTCACTCTCCCACTGTGGAAGAACATGATGCTCGTGTACGCC
ATTGCCCTGTCGATGGCGCTGCACTTTGCACTGCTCTACACGCCCTTCCTCCAGAGCCTGTTTGCCATCCTCCCG
CTCAACCGCGAGGAGTGGAACGCGGTACTGATTCTCAGCGCTCCGGTCATTCTCCTGGACGAGGTGCTCAAGTTG
TTTGAACGCAACTATTTCATGCAGACGGCGCCGGACGTGGCCATGGTCGCCCGGGCAAGCAAGAAGAAGAGGTAG
Gene >Ophcf2|04411
ATGGACAACGCCTTCGCCCGTCCGATTACGGCGGTGCTCGCCGAGTTCCAAGTTGACGAGCACAAGGGCCTCAGC
GACTCTCAGGTTCGCCAGCTGCGCAACAAGCACGGCCGCAATGGTAACTTGCACCGACCCCTGCCGTATCCCCTT
GCCCTTGGTCGCATTGCTAATACCTATCCATCGTCGCAGCCATTCCCGAGGAACCTCCGACGCCCATCTGGGAGC
TCATCTTGGAGCAGTTCAAGGACCAGCTCGTCATCATCCTTCTTGGTTCCGCTGCCGTATCCTTCGTCTTGGCTC
TGTTTGAGGACCAGGGCGGCTGGAGCGCCTTTGTCGACCCTATCGTGGTATGTTGTTCCTTTGGGCCTCGTACGA
ACTCGCTGACGAGTCGCATAGATCCTCACTATCCTCGTCCTCAACGCCGTCGTTGGAGTCTCCCAGGAAAGCAGC
GCAGAAAAGGCTATTGCCGCTCTCCAGGAATATTCAGCAAACGAGTCCAATGTCATCCGCAATGGAGGCCACATC
GCCCGTCTCAAAGCCGAGGAGTTGGTACCCGGCGACATCGTCACGGTGGCCGTCGGGGATCGCATCCCTGCCGAC
TGCCGCCTTGTTTCCATCGAGAGCAACAGCTTCGCCGTCGACCAGGCCATCCTCACGGGCGAGAGCGAGAGCGTC
GGCAAGGAACAGCTCGTCGTCAAGGATGAGCGTGCTGTGCTGCAGGATCAGGTCAATATGCTCTTCTCCGGAACG
ACCGTCGTCATCGGCCGAGCCAAGGCTGTCGTTGTCTTGACCGGCCCCAACACGGCCATCGGCGACATTCACGAG
AGCATCACAGCCCAGATCTCGGAACCTACGCCGCTGAAGCAGAAGCTCAACGATTTCGGTGACAGCCTCGCCAAG
GTTATCACCCTCATCTGCATCCTCGTCTGGCTCATCAACATCCCCAACTTCAACGACCCCAGCCACGGCACCTGG
GCCAAAGGCGCCATCTACTATCTCAAGATTGCAGTCTCGCTGGGCGTCGCCGCCATTCCTGAGGGTCTGGCAGTC
GTCATCACCACCTGTCTGGCGCTTGGCACCCGCAAGATGGCGGCCAAGAACGCCGTCGTCCGCAGCCTCCCCTCG
GTCGAGACGCTCGGCAGCTGCAGCGTCATCTGCTCCGACAAGACGGGCACGCTCACCACCAACCAGATGAGCGTC
AGCAAAGTCGTCTATCTCGACGAGCAGGGCTCCGACCTCGTGGAGCTCGACGTAGAGGGTACGACATTTGCGCCT
ACGGGCGCCGTCTGCATGGCAGGACAAGCCGTCGACGATCTGCCGTCCAAGTCGGACACGATACGCCAGATGGCC
GAGGTAGCCGCCTTGTGCAACGACTCCTACCTGGCCTACGACTCGCGAACGGCCACCTTTTCGACAGTGGGCGAG
CCCACCGAGGGCGCCCTCAGGGTTCTCGTCGAGAAGCTTGGGCCCAGACCCCCTACCGGCACGCATCCCGACGAC
TGCGTCCATTATGCCAGCGCCAAGCACGAGAAGCAGCTCCCCAGGCTGGCCACGTATGAGTTCTCGCGGGACCGA
AAGAGCATGTCAGTCCTTGTCAAGAGCGGTAAGCAGCAGAAGAAGCTGCTCGTCAAGGGAGCGCCCGAGTCCATC
CTGGAGCGCTGCACCCATGCCCTCGTCGGCGCCAATGGCAAGCGAGTCGCGCTCAACAACAAACTTTCGGAACTA
GTGCTCCGAGAGGTGGTCGAATACGGGGACCGTGGCCTCCGTATCATGGCGCTGGCCAGCATCGACGACGTGTCC
AATAACCCACGACTGTCGGCCAAGACGACAAGTCAGTACGCCGAGCTCGAGCAGAACATGACGTTCCTGGGCCTG
GTCGGCATGCTGGATCCTCCCCGCAAAGAGGTGCCCAGGTCGATTGCGCAGTGCAAGAAGGCCGGCATCCGGATC
ATCGTCATCACGGGAGACAACCGCTACACGGCCGAGAGCATCTGCCGGCAGATTGGCGTCTTTGGGCCCAACGAA
GACCTCAAGGGCAAGAGCTTCACGGGCCGCGAGTTTGAAAACCTCAGCCCGGGCGAGCAGCTCAAGGCGGCCAAG
CGAGCCTCTCTCTTCTCCCGCGTAGAGCCAGGGCACAAGTCGCGGCTCGTCGACCTCCTCCAATCGCTGGGTGAG
GTGGTGGCCATGACGGGCGATGGCGTCAACGACGCTCCGGCGCTCAAAAAGGCCGACATCGGCGTTGCCATGGGC
TCTGGCACCGACGTTTCCAAGTTGGCGGCCGACATGGTGCTGGCCGACAGCAACTTCGCCACCATCGAGGTGGCT
ATCGAGGAGGGCCGAGCCATCTACAGCAACACGCAGCAGTTCATCCGCTACCTCATCTCGTCCAACATTGGCGAG
GTTGTGTCCATCTTCCTGACGGCGGCTCTGGGCATGCCCGAGGCGCTGATTCCGGTTCAGCTGCTCTGGGTCAAC
CTGGTGACGGATGGCTTGCCGGCCACGGCCCTCTCCTTCAACCCGCCCGACAACGACATCATGAAGCGACAGCCG
CGGAAGAGGGACGAGCCTCTGATCGGCGGCTGGCTGTTCCTGCGCTACCTCATCATCGGTACTTACGTCGGCATC
GCCACCGTGGCCGGCTACGCCTGGTGGTTCATGTACTACGCGGGAGGCCCCCAGATCACCTTTAAGCAGCTGTCA
CGCTTCCACCACTGCTCGACCGAGTTTCCGGAGATTGGCTGTTCCATGTTCTCGGACCAGAGGGCGCGGGCGGGC
TCGACCATGTCTTTGTCGATTCTGGTCGTGATTGAGATGTTCAACGCCATGAACGCCCTGTCGTCGAGCGCGTCG
CTGCTCACTCTCCCACTGTGGAAGAACATGATGCTCGTGTACGCCATTGCCCTGTCGATGGCGCTGCACTTTGCA
CTGCTCTACACGCCCTTCCTCCAGAGCCTGTTTGCCATCCTCCCGCTCAACCGCGAGGAGTGGAACGCGGTACTG
ATTCTCAGCGCTCCGGTCATGTGAGTTGTTATCGTATATCGTGTTGGTCGTCCTGAACTAACGTATCCGTCGCAG
TCTCCTGGACGAGGTGCTCAAGTTGTTTGAACGCAACTATTTCATGCAGACGGCGCCGGACGTGGCCATGGTCGC
CCGGGCAAGCAAGAAGAAGAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail