Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04411
Gene name
Locationscaffold_04:3182215..3185390
Strand+
Gene length (bp)3175
Transcript length (bp)3000
Coding sequence length (bp)3000
Protein length (aa) 1000

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 1.5E-47 122 326
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 3.4E-47 773 976
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.1E-19 344 704
PF13246 Cation_ATPase Cation transport ATPase (P-type) 8.4E-21 414 516
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 4.7E-19 7 72
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 3.2E-06 684 729

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 61 78 17
2 83 105 22
3 258 277 19
4 297 319 22
5 749 771 22
6 781 800 19
7 821 843 22
8 920 942 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04411
MDNAFARPITAVLAEFQVDEHKGLSDSQVRQLRNKHGRNAIPEEPPTPIWELILEQFKDQLVIILLGSAAVSFVL
ALFEDQGGWSAFVDPIVILTILVLNAVVGVSQESSAEKAIAALQEYSANESNVIRNGGHIARLKAEELVPGDIVT
VAVGDRIPADCRLVSIESNSFAVDQAILTGESESVGKEQLVVKDERAVLQDQVNMLFSGTTVVIGRAKAVVVLTG
PNTAIGDIHESITAQISEPTPLKQKLNDFGDSLAKVITLICILVWLINIPNFNDPSHGTWAKGAIYYLKIAVSLG
VAAIPEGLAVVITTCLALGTRKMAAKNAVVRSLPSVETLGSCSVICSDKTGTLTTNQMSVSKVVYLDEQGSDLVE
LDVEGTTFAPTGAVCMAGQAVDDLPSKSDTIRQMAEVAALCNDSYLAYDSRTATFSTVGEPTEGALRVLVEKLGP
RPPTGTHPDDCVHYASAKHEKQLPRLATYEFSRDRKSMSVLVKSGKQQKKLLVKGAPESILERCTHALVGANGKR
VALNNKLSELVLREVVEYGDRGLRIMALASIDDVSNNPRLSAKTTSQYAELEQNMTFLGLVGMLDPPRKEVPRSI
AQCKKAGIRIIVITGDNRYTAESICRQIGVFGPNEDLKGKSFTGREFENLSPGEQLKAAKRASLFSRVEPGHKSR
LVDLLQSLGEVVAMTGDGVNDAPALKKADIGVAMGSGTDVSKLAADMVLADSNFATIEVAIEEGRAIYSNTQQFI
RYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLVTDGLPATALSFNPPDNDIMKRQPRKRDEPLIGGWLFLR
YLIIGTYVGIATVAGYAWWFMYYAGGPQITFKQLSRFHHCSTEFPEIGCSMFSDQRARAGSTMSLSILVVIEMFN
AMNALSSSASLLTLPLWKNMMLVYAIALSMALHFALLYTPFLQSLFAILPLNREEWNAVLILSAPVILLDEVLKL
FERNYFMQTAPDVAMVARASKKKR*
Coding >Ophcf2|04411
ATGGACAACGCCTTCGCCCGTCCGATTACGGCGGTGCTCGCCGAGTTCCAAGTTGACGAGCACAAGGGCCTCAGC
GACTCTCAGGTTCGCCAGCTGCGCAACAAGCACGGCCGCAATGCCATTCCCGAGGAACCTCCGACGCCCATCTGG
GAGCTCATCTTGGAGCAGTTCAAGGACCAGCTCGTCATCATCCTTCTTGGTTCCGCTGCCGTATCCTTCGTCTTG
GCTCTGTTTGAGGACCAGGGCGGCTGGAGCGCCTTTGTCGACCCTATCGTGATCCTCACTATCCTCGTCCTCAAC
GCCGTCGTTGGAGTCTCCCAGGAAAGCAGCGCAGAAAAGGCTATTGCCGCTCTCCAGGAATATTCAGCAAACGAG
TCCAATGTCATCCGCAATGGAGGCCACATCGCCCGTCTCAAAGCCGAGGAGTTGGTACCCGGCGACATCGTCACG
GTGGCCGTCGGGGATCGCATCCCTGCCGACTGCCGCCTTGTTTCCATCGAGAGCAACAGCTTCGCCGTCGACCAG
GCCATCCTCACGGGCGAGAGCGAGAGCGTCGGCAAGGAACAGCTCGTCGTCAAGGATGAGCGTGCTGTGCTGCAG
GATCAGGTCAATATGCTCTTCTCCGGAACGACCGTCGTCATCGGCCGAGCCAAGGCTGTCGTTGTCTTGACCGGC
CCCAACACGGCCATCGGCGACATTCACGAGAGCATCACAGCCCAGATCTCGGAACCTACGCCGCTGAAGCAGAAG
CTCAACGATTTCGGTGACAGCCTCGCCAAGGTTATCACCCTCATCTGCATCCTCGTCTGGCTCATCAACATCCCC
AACTTCAACGACCCCAGCCACGGCACCTGGGCCAAAGGCGCCATCTACTATCTCAAGATTGCAGTCTCGCTGGGC
GTCGCCGCCATTCCTGAGGGTCTGGCAGTCGTCATCACCACCTGTCTGGCGCTTGGCACCCGCAAGATGGCGGCC
AAGAACGCCGTCGTCCGCAGCCTCCCCTCGGTCGAGACGCTCGGCAGCTGCAGCGTCATCTGCTCCGACAAGACG
GGCACGCTCACCACCAACCAGATGAGCGTCAGCAAAGTCGTCTATCTCGACGAGCAGGGCTCCGACCTCGTGGAG
CTCGACGTAGAGGGTACGACATTTGCGCCTACGGGCGCCGTCTGCATGGCAGGACAAGCCGTCGACGATCTGCCG
TCCAAGTCGGACACGATACGCCAGATGGCCGAGGTAGCCGCCTTGTGCAACGACTCCTACCTGGCCTACGACTCG
CGAACGGCCACCTTTTCGACAGTGGGCGAGCCCACCGAGGGCGCCCTCAGGGTTCTCGTCGAGAAGCTTGGGCCC
AGACCCCCTACCGGCACGCATCCCGACGACTGCGTCCATTATGCCAGCGCCAAGCACGAGAAGCAGCTCCCCAGG
CTGGCCACGTATGAGTTCTCGCGGGACCGAAAGAGCATGTCAGTCCTTGTCAAGAGCGGTAAGCAGCAGAAGAAG
CTGCTCGTCAAGGGAGCGCCCGAGTCCATCCTGGAGCGCTGCACCCATGCCCTCGTCGGCGCCAATGGCAAGCGA
GTCGCGCTCAACAACAAACTTTCGGAACTAGTGCTCCGAGAGGTGGTCGAATACGGGGACCGTGGCCTCCGTATC
ATGGCGCTGGCCAGCATCGACGACGTGTCCAATAACCCACGACTGTCGGCCAAGACGACAAGTCAGTACGCCGAG
CTCGAGCAGAACATGACGTTCCTGGGCCTGGTCGGCATGCTGGATCCTCCCCGCAAAGAGGTGCCCAGGTCGATT
GCGCAGTGCAAGAAGGCCGGCATCCGGATCATCGTCATCACGGGAGACAACCGCTACACGGCCGAGAGCATCTGC
CGGCAGATTGGCGTCTTTGGGCCCAACGAAGACCTCAAGGGCAAGAGCTTCACGGGCCGCGAGTTTGAAAACCTC
AGCCCGGGCGAGCAGCTCAAGGCGGCCAAGCGAGCCTCTCTCTTCTCCCGCGTAGAGCCAGGGCACAAGTCGCGG
CTCGTCGACCTCCTCCAATCGCTGGGTGAGGTGGTGGCCATGACGGGCGATGGCGTCAACGACGCTCCGGCGCTC
AAAAAGGCCGACATCGGCGTTGCCATGGGCTCTGGCACCGACGTTTCCAAGTTGGCGGCCGACATGGTGCTGGCC
GACAGCAACTTCGCCACCATCGAGGTGGCTATCGAGGAGGGCCGAGCCATCTACAGCAACACGCAGCAGTTCATC
CGCTACCTCATCTCGTCCAACATTGGCGAGGTTGTGTCCATCTTCCTGACGGCGGCTCTGGGCATGCCCGAGGCG
CTGATTCCGGTTCAGCTGCTCTGGGTCAACCTGGTGACGGATGGCTTGCCGGCCACGGCCCTCTCCTTCAACCCG
CCCGACAACGACATCATGAAGCGACAGCCGCGGAAGAGGGACGAGCCTCTGATCGGCGGCTGGCTGTTCCTGCGC
TACCTCATCATCGGTACTTACGTCGGCATCGCCACCGTGGCCGGCTACGCCTGGTGGTTCATGTACTACGCGGGA
GGCCCCCAGATCACCTTTAAGCAGCTGTCACGCTTCCACCACTGCTCGACCGAGTTTCCGGAGATTGGCTGTTCC
ATGTTCTCGGACCAGAGGGCGCGGGCGGGCTCGACCATGTCTTTGTCGATTCTGGTCGTGATTGAGATGTTCAAC
GCCATGAACGCCCTGTCGTCGAGCGCGTCGCTGCTCACTCTCCCACTGTGGAAGAACATGATGCTCGTGTACGCC
ATTGCCCTGTCGATGGCGCTGCACTTTGCACTGCTCTACACGCCCTTCCTCCAGAGCCTGTTTGCCATCCTCCCG
CTCAACCGCGAGGAGTGGAACGCGGTACTGATTCTCAGCGCTCCGGTCATTCTCCTGGACGAGGTGCTCAAGTTG
TTTGAACGCAACTATTTCATGCAGACGGCGCCGGACGTGGCCATGGTCGCCCGGGCAAGCAAGAAGAAGAGGTAG
Transcript >Ophcf2|04411
ATGGACAACGCCTTCGCCCGTCCGATTACGGCGGTGCTCGCCGAGTTCCAAGTTGACGAGCACAAGGGCCTCAGC
GACTCTCAGGTTCGCCAGCTGCGCAACAAGCACGGCCGCAATGCCATTCCCGAGGAACCTCCGACGCCCATCTGG
GAGCTCATCTTGGAGCAGTTCAAGGACCAGCTCGTCATCATCCTTCTTGGTTCCGCTGCCGTATCCTTCGTCTTG
GCTCTGTTTGAGGACCAGGGCGGCTGGAGCGCCTTTGTCGACCCTATCGTGATCCTCACTATCCTCGTCCTCAAC
GCCGTCGTTGGAGTCTCCCAGGAAAGCAGCGCAGAAAAGGCTATTGCCGCTCTCCAGGAATATTCAGCAAACGAG
TCCAATGTCATCCGCAATGGAGGCCACATCGCCCGTCTCAAAGCCGAGGAGTTGGTACCCGGCGACATCGTCACG
GTGGCCGTCGGGGATCGCATCCCTGCCGACTGCCGCCTTGTTTCCATCGAGAGCAACAGCTTCGCCGTCGACCAG
GCCATCCTCACGGGCGAGAGCGAGAGCGTCGGCAAGGAACAGCTCGTCGTCAAGGATGAGCGTGCTGTGCTGCAG
GATCAGGTCAATATGCTCTTCTCCGGAACGACCGTCGTCATCGGCCGAGCCAAGGCTGTCGTTGTCTTGACCGGC
CCCAACACGGCCATCGGCGACATTCACGAGAGCATCACAGCCCAGATCTCGGAACCTACGCCGCTGAAGCAGAAG
CTCAACGATTTCGGTGACAGCCTCGCCAAGGTTATCACCCTCATCTGCATCCTCGTCTGGCTCATCAACATCCCC
AACTTCAACGACCCCAGCCACGGCACCTGGGCCAAAGGCGCCATCTACTATCTCAAGATTGCAGTCTCGCTGGGC
GTCGCCGCCATTCCTGAGGGTCTGGCAGTCGTCATCACCACCTGTCTGGCGCTTGGCACCCGCAAGATGGCGGCC
AAGAACGCCGTCGTCCGCAGCCTCCCCTCGGTCGAGACGCTCGGCAGCTGCAGCGTCATCTGCTCCGACAAGACG
GGCACGCTCACCACCAACCAGATGAGCGTCAGCAAAGTCGTCTATCTCGACGAGCAGGGCTCCGACCTCGTGGAG
CTCGACGTAGAGGGTACGACATTTGCGCCTACGGGCGCCGTCTGCATGGCAGGACAAGCCGTCGACGATCTGCCG
TCCAAGTCGGACACGATACGCCAGATGGCCGAGGTAGCCGCCTTGTGCAACGACTCCTACCTGGCCTACGACTCG
CGAACGGCCACCTTTTCGACAGTGGGCGAGCCCACCGAGGGCGCCCTCAGGGTTCTCGTCGAGAAGCTTGGGCCC
AGACCCCCTACCGGCACGCATCCCGACGACTGCGTCCATTATGCCAGCGCCAAGCACGAGAAGCAGCTCCCCAGG
CTGGCCACGTATGAGTTCTCGCGGGACCGAAAGAGCATGTCAGTCCTTGTCAAGAGCGGTAAGCAGCAGAAGAAG
CTGCTCGTCAAGGGAGCGCCCGAGTCCATCCTGGAGCGCTGCACCCATGCCCTCGTCGGCGCCAATGGCAAGCGA
GTCGCGCTCAACAACAAACTTTCGGAACTAGTGCTCCGAGAGGTGGTCGAATACGGGGACCGTGGCCTCCGTATC
ATGGCGCTGGCCAGCATCGACGACGTGTCCAATAACCCACGACTGTCGGCCAAGACGACAAGTCAGTACGCCGAG
CTCGAGCAGAACATGACGTTCCTGGGCCTGGTCGGCATGCTGGATCCTCCCCGCAAAGAGGTGCCCAGGTCGATT
GCGCAGTGCAAGAAGGCCGGCATCCGGATCATCGTCATCACGGGAGACAACCGCTACACGGCCGAGAGCATCTGC
CGGCAGATTGGCGTCTTTGGGCCCAACGAAGACCTCAAGGGCAAGAGCTTCACGGGCCGCGAGTTTGAAAACCTC
AGCCCGGGCGAGCAGCTCAAGGCGGCCAAGCGAGCCTCTCTCTTCTCCCGCGTAGAGCCAGGGCACAAGTCGCGG
CTCGTCGACCTCCTCCAATCGCTGGGTGAGGTGGTGGCCATGACGGGCGATGGCGTCAACGACGCTCCGGCGCTC
AAAAAGGCCGACATCGGCGTTGCCATGGGCTCTGGCACCGACGTTTCCAAGTTGGCGGCCGACATGGTGCTGGCC
GACAGCAACTTCGCCACCATCGAGGTGGCTATCGAGGAGGGCCGAGCCATCTACAGCAACACGCAGCAGTTCATC
CGCTACCTCATCTCGTCCAACATTGGCGAGGTTGTGTCCATCTTCCTGACGGCGGCTCTGGGCATGCCCGAGGCG
CTGATTCCGGTTCAGCTGCTCTGGGTCAACCTGGTGACGGATGGCTTGCCGGCCACGGCCCTCTCCTTCAACCCG
CCCGACAACGACATCATGAAGCGACAGCCGCGGAAGAGGGACGAGCCTCTGATCGGCGGCTGGCTGTTCCTGCGC
TACCTCATCATCGGTACTTACGTCGGCATCGCCACCGTGGCCGGCTACGCCTGGTGGTTCATGTACTACGCGGGA
GGCCCCCAGATCACCTTTAAGCAGCTGTCACGCTTCCACCACTGCTCGACCGAGTTTCCGGAGATTGGCTGTTCC
ATGTTCTCGGACCAGAGGGCGCGGGCGGGCTCGACCATGTCTTTGTCGATTCTGGTCGTGATTGAGATGTTCAAC
GCCATGAACGCCCTGTCGTCGAGCGCGTCGCTGCTCACTCTCCCACTGTGGAAGAACATGATGCTCGTGTACGCC
ATTGCCCTGTCGATGGCGCTGCACTTTGCACTGCTCTACACGCCCTTCCTCCAGAGCCTGTTTGCCATCCTCCCG
CTCAACCGCGAGGAGTGGAACGCGGTACTGATTCTCAGCGCTCCGGTCATTCTCCTGGACGAGGTGCTCAAGTTG
TTTGAACGCAACTATTTCATGCAGACGGCGCCGGACGTGGCCATGGTCGCCCGGGCAAGCAAGAAGAAGAGGTAG
Gene >Ophcf2|04411
ATGGACAACGCCTTCGCCCGTCCGATTACGGCGGTGCTCGCCGAGTTCCAAGTTGACGAGCACAAGGGCCTCAGC
GACTCTCAGGTTCGCCAGCTGCGCAACAAGCACGGCCGCAATGGTAACTTGCACCGACCCCTGCCGTATCCCCTT
GCCCTTGGTCGCATTGCTAATACCTATCCATCGTCGCAGCCATTCCCGAGGAACCTCCGACGCCCATCTGGGAGC
TCATCTTGGAGCAGTTCAAGGACCAGCTCGTCATCATCCTTCTTGGTTCCGCTGCCGTATCCTTCGTCTTGGCTC
TGTTTGAGGACCAGGGCGGCTGGAGCGCCTTTGTCGACCCTATCGTGGTATGTTGTTCCTTTGGGCCTCGTACGA
ACTCGCTGACGAGTCGCATAGATCCTCACTATCCTCGTCCTCAACGCCGTCGTTGGAGTCTCCCAGGAAAGCAGC
GCAGAAAAGGCTATTGCCGCTCTCCAGGAATATTCAGCAAACGAGTCCAATGTCATCCGCAATGGAGGCCACATC
GCCCGTCTCAAAGCCGAGGAGTTGGTACCCGGCGACATCGTCACGGTGGCCGTCGGGGATCGCATCCCTGCCGAC
TGCCGCCTTGTTTCCATCGAGAGCAACAGCTTCGCCGTCGACCAGGCCATCCTCACGGGCGAGAGCGAGAGCGTC
GGCAAGGAACAGCTCGTCGTCAAGGATGAGCGTGCTGTGCTGCAGGATCAGGTCAATATGCTCTTCTCCGGAACG
ACCGTCGTCATCGGCCGAGCCAAGGCTGTCGTTGTCTTGACCGGCCCCAACACGGCCATCGGCGACATTCACGAG
AGCATCACAGCCCAGATCTCGGAACCTACGCCGCTGAAGCAGAAGCTCAACGATTTCGGTGACAGCCTCGCCAAG
GTTATCACCCTCATCTGCATCCTCGTCTGGCTCATCAACATCCCCAACTTCAACGACCCCAGCCACGGCACCTGG
GCCAAAGGCGCCATCTACTATCTCAAGATTGCAGTCTCGCTGGGCGTCGCCGCCATTCCTGAGGGTCTGGCAGTC
GTCATCACCACCTGTCTGGCGCTTGGCACCCGCAAGATGGCGGCCAAGAACGCCGTCGTCCGCAGCCTCCCCTCG
GTCGAGACGCTCGGCAGCTGCAGCGTCATCTGCTCCGACAAGACGGGCACGCTCACCACCAACCAGATGAGCGTC
AGCAAAGTCGTCTATCTCGACGAGCAGGGCTCCGACCTCGTGGAGCTCGACGTAGAGGGTACGACATTTGCGCCT
ACGGGCGCCGTCTGCATGGCAGGACAAGCCGTCGACGATCTGCCGTCCAAGTCGGACACGATACGCCAGATGGCC
GAGGTAGCCGCCTTGTGCAACGACTCCTACCTGGCCTACGACTCGCGAACGGCCACCTTTTCGACAGTGGGCGAG
CCCACCGAGGGCGCCCTCAGGGTTCTCGTCGAGAAGCTTGGGCCCAGACCCCCTACCGGCACGCATCCCGACGAC
TGCGTCCATTATGCCAGCGCCAAGCACGAGAAGCAGCTCCCCAGGCTGGCCACGTATGAGTTCTCGCGGGACCGA
AAGAGCATGTCAGTCCTTGTCAAGAGCGGTAAGCAGCAGAAGAAGCTGCTCGTCAAGGGAGCGCCCGAGTCCATC
CTGGAGCGCTGCACCCATGCCCTCGTCGGCGCCAATGGCAAGCGAGTCGCGCTCAACAACAAACTTTCGGAACTA
GTGCTCCGAGAGGTGGTCGAATACGGGGACCGTGGCCTCCGTATCATGGCGCTGGCCAGCATCGACGACGTGTCC
AATAACCCACGACTGTCGGCCAAGACGACAAGTCAGTACGCCGAGCTCGAGCAGAACATGACGTTCCTGGGCCTG
GTCGGCATGCTGGATCCTCCCCGCAAAGAGGTGCCCAGGTCGATTGCGCAGTGCAAGAAGGCCGGCATCCGGATC
ATCGTCATCACGGGAGACAACCGCTACACGGCCGAGAGCATCTGCCGGCAGATTGGCGTCTTTGGGCCCAACGAA
GACCTCAAGGGCAAGAGCTTCACGGGCCGCGAGTTTGAAAACCTCAGCCCGGGCGAGCAGCTCAAGGCGGCCAAG
CGAGCCTCTCTCTTCTCCCGCGTAGAGCCAGGGCACAAGTCGCGGCTCGTCGACCTCCTCCAATCGCTGGGTGAG
GTGGTGGCCATGACGGGCGATGGCGTCAACGACGCTCCGGCGCTCAAAAAGGCCGACATCGGCGTTGCCATGGGC
TCTGGCACCGACGTTTCCAAGTTGGCGGCCGACATGGTGCTGGCCGACAGCAACTTCGCCACCATCGAGGTGGCT
ATCGAGGAGGGCCGAGCCATCTACAGCAACACGCAGCAGTTCATCCGCTACCTCATCTCGTCCAACATTGGCGAG
GTTGTGTCCATCTTCCTGACGGCGGCTCTGGGCATGCCCGAGGCGCTGATTCCGGTTCAGCTGCTCTGGGTCAAC
CTGGTGACGGATGGCTTGCCGGCCACGGCCCTCTCCTTCAACCCGCCCGACAACGACATCATGAAGCGACAGCCG
CGGAAGAGGGACGAGCCTCTGATCGGCGGCTGGCTGTTCCTGCGCTACCTCATCATCGGTACTTACGTCGGCATC
GCCACCGTGGCCGGCTACGCCTGGTGGTTCATGTACTACGCGGGAGGCCCCCAGATCACCTTTAAGCAGCTGTCA
CGCTTCCACCACTGCTCGACCGAGTTTCCGGAGATTGGCTGTTCCATGTTCTCGGACCAGAGGGCGCGGGCGGGC
TCGACCATGTCTTTGTCGATTCTGGTCGTGATTGAGATGTTCAACGCCATGAACGCCCTGTCGTCGAGCGCGTCG
CTGCTCACTCTCCCACTGTGGAAGAACATGATGCTCGTGTACGCCATTGCCCTGTCGATGGCGCTGCACTTTGCA
CTGCTCTACACGCCCTTCCTCCAGAGCCTGTTTGCCATCCTCCCGCTCAACCGCGAGGAGTGGAACGCGGTACTG
ATTCTCAGCGCTCCGGTCATGTGAGTTGTTATCGTATATCGTGTTGGTCGTCCTGAACTAACGTATCCGTCGCAG
TCTCCTGGACGAGGTGCTCAAGTTGTTTGAACGCAACTATTTCATGCAGACGGCGCCGGACGTGGCCATGGTCGC
CCGGGCAAGCAAGAAGAAGAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail