Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04404
Gene name
Locationscaffold_04:3161090..3164905
Strand+
Gene length (bp)3815
Transcript length (bp)3618
Coding sequence length (bp)3618
Protein length (aa) 1206

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 4.7E-286 674 1200
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.9E-12 876 1137
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 2.6E-06 875 1044

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 231 253 22
2 492 514 22
3 1071 1093 22
4 1105 1127 22
5 1131 1153 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04404
MSLPERPGASPPQDHRSSYRQSSSRRLPPLDVEAAAYQGSSRPRQQHHHLHHQHDVPLSSTDPAAHDGPSSSEPF
PRKRSLIRPERTRIGKDHRNYHYHKHAANMDVLPSSTGNDPILEHLDGSTERSGGSLPNGSFTDSPPRRNDVTEH
EKTPERTRPRQPKATKIAKPTKRERRPSRKKQKVVENQLRPPSLWNVYCAIITFWCPDFILRCFGKPTKAQRRAW
REKMGLISIILFIMAIVGFLTFGFTATVCRAPPLRLRTNEVSDGYMIFHGVAYDLASSHHPPARGIPLRQDGMGA
NVLFDLPEKHGGQDGSFLFQNVNGKCKGVITRAPGSDVPSNAADDLAWYFPCTIFNQDGSTAPNLTIPYYLGYAC
HTTQNARDAFYRGLNGAADVYFTWDDIKNSSRNLIVYSGAVLDLNLLNWFNESQVSIPDRFKELRDTRSVVNRAV
RGRDVTRLFQSSDDKRYAQCFEEIIKVGSVDTETVGCIASKVVLYCALVLILSVVLARFMLALVFQWFISRNYAA
SKTSQSSNRRKRNQQIEAWSEDIYRAPARLPGDVGSTVASSNKRSSSFLPTTSRFSTVYGADRGGGGGGGGGDRG
GGGGGGGGVGGGGGAGGGGGGHRRIPTTMTSQGASGSLLSPHSIYRHGNDSRASFLRTETFGSSNMGEGPGPAGF
IHDAVVPQPPSDWMPFGFPLAHTMCLVTAYSEGEEGIRTTLDSIATTDYPNSHKAIVVICDGIIKGKGEAVSTPD
VCLGMLRDHSTPPELVQPFSYVAVASGSKRHNMAKVYCGFYDYGARSQIPPDRQQRVPMMVIVKCGTPAEEAAKS
KPGNRGKRDSQIILMSFLQKVMFDERMTELEYEMFNGLWKVTGISPDYYEIVLMVDADTKVFPDSLTHMVSAMVK
DPEIMGLCGETKIANKRDSWVTAIQVFEYFVSHHLAKSFESVFGGVTCLPGCFCMYRIKAPKGGQNYWVPILANP
DIVEHYSENVVETLHEKNLYLLGEDRFLTTLMLRTFPKRKQVFVPQAVCKTTVPDKFMVLLSQRRRWINSTIHNL
MELVLVRDLCGTFCFSMQFVIFVELVGTLVLPAAIAFTFYVVITSIVHSPPQIIPLVLLALILGLPGVLIIVTAH
SWSYVIWMMIYLLSLPVWNFVLPTYAFWKFDDFSWGDTRKTAGESKKGGGGGHEDEGEFDSSKITMKRWAEFERE
RRISL*
Coding >Ophcf2|04404
ATGTCGCTGCCAGAGAGGCCCGGCGCCAGTCCTCCCCAGGACCACCGCAGCTCATACAGGCAATCTTCGTCCCGT
CGACTGCCCCCCCTCGACGTCGAAGCGGCCGCCTACCAGGGCTCATCCAGACCCAGACAGCAGCATCATCATCTT
CATCATCAACACGACGTTCCGCTGTCTTCTACTGACCCCGCTGCCCATGACGGCCCATCCTCCTCCGAGCCCTTT
CCCCGCAAGAGGAGCCTCATCAGGCCGGAGAGGACGAGGATCGGAAAGGATCATCGTAACTATCATTACCACAAG
CATGCCGCCAACATGGACGTCCTGCCCTCTTCCACCGGCAACGACCCCATACTCGAGCACCTCGACGGCTCCACC
GAACGATCTGGCGGCTCCCTGCCCAATGGGAGCTTCACCGATTCTCCCCCTCGCCGCAACGACGTAACCGAGCAT
GAAAAGACTCCCGAGCGTACGAGGCCTCGACAGCCCAAGGCGACAAAGATTGCCAAGCCGACAAAGAGAGAGCGG
CGGCCTTCACGTAAGAAGCAAAAGGTGGTGGAGAATCAGCTGAGACCGCCGAGCCTATGGAACGTCTACTGCGCC
ATCATCACCTTTTGGTGCCCCGACTTCATATTGAGATGCTTCGGCAAGCCCACAAAGGCCCAGCGCCGGGCGTGG
AGGGAAAAGATGGGGCTCATCAGCATCATCCTCTTCATCATGGCCATCGTCGGCTTCCTGACCTTTGGCTTCACC
GCCACCGTCTGCCGCGCGCCCCCCCTACGCCTCCGCACCAACGAGGTGTCGGACGGTTACATGATCTTCCACGGC
GTCGCCTACGATCTCGCCAGCTCCCACCACCCTCCCGCCCGGGGCATCCCCCTGCGCCAGGACGGCATGGGCGCC
AACGTCCTCTTCGATCTCCCGGAGAAGCACGGCGGCCAGGACGGGAGCTTCCTCTTCCAAAACGTCAACGGCAAA
TGCAAGGGCGTCATCACCCGGGCTCCGGGCTCCGACGTGCCGTCCAACGCCGCCGACGACCTGGCTTGGTACTTT
CCCTGCACCATCTTCAACCAGGACGGTTCGACTGCGCCCAACCTCACGATCCCCTACTACCTCGGCTATGCCTGC
CACACGACGCAAAACGCCCGTGACGCCTTTTACCGCGGTCTCAACGGCGCCGCCGACGTCTACTTTACTTGGGAC
GACATCAAGAACAGCTCGCGCAACCTCATCGTCTACTCGGGCGCCGTGCTCGACCTCAACCTGCTCAACTGGTTC
AACGAGAGCCAGGTATCCATCCCCGACCGCTTCAAGGAGCTGCGAGACACGCGCAGCGTCGTCAACAGGGCCGTC
CGCGGCCGCGACGTCACGCGCCTGTTCCAGTCGTCGGACGACAAGCGCTACGCCCAGTGCTTCGAGGAGATCATC
AAGGTCGGCTCCGTCGACACCGAGACGGTCGGCTGCATCGCCTCCAAGGTGGTGCTGTACTGCGCCCTCGTCCTG
ATCCTGTCGGTGGTGCTGGCCCGGTTCATGCTGGCCCTCGTCTTCCAGTGGTTCATCAGCCGGAACTACGCCGCT
TCCAAGACGTCGCAGAGCTCCAACCGCAGGAAGCGCAACCAGCAGATCGAGGCCTGGTCCGAGGACATCTACCGC
GCCCCCGCCAGGCTGCCCGGTGACGTGGGCAGCACCGTCGCCAGCTCCAACAAGCGAAGCTCGTCCTTTCTGCCC
ACCACCTCCCGCTTCTCGACAGTCTACGGGGCCGACCGAGGCGGAGGCGGCGGCGGAGGAGGAGGAGACCGAGGA
GGAGGCGGAGGAGGAGGAGGAGGAGTTGGAGGAGGAGGAGGCGCAGGAGGCGGAGGAGGCGGCCATCGACGGATC
CCGACGACCATGACCAGCCAGGGCGCGTCGGGCTCGCTGCTCAGCCCGCACTCCATCTACCGGCACGGCAACGAC
AGCCGGGCGAGCTTCCTCCGGACCGAGACGTTCGGAAGCTCCAACATGGGCGAGGGCCCCGGACCGGCGGGCTTC
ATCCACGACGCCGTCGTGCCGCAGCCGCCGTCGGACTGGATGCCGTTTGGGTTCCCGCTGGCGCACACCATGTGT
CTGGTGACGGCCTACTCGGAGGGCGAAGAGGGCATCCGCACCACGCTAGACTCCATCGCGACGACGGACTACCCC
AACAGCCACAAGGCCATCGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGCGAGGCCGTGTCGACGCCCGAC
GTGTGCCTGGGCATGCTCCGGGACCACTCGACGCCGCCGGAGCTGGTACAGCCCTTCTCGTACGTGGCCGTGGCG
AGCGGATCGAAGCGGCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTACGGGGCCCGTTCTCAGATCCCC
CCGGACAGGCAGCAGCGCGTGCCCATGATGGTCATCGTCAAGTGCGGCACGCCGGCCGAGGAAGCGGCCAAGTCG
AAGCCGGGCAACCGCGGTAAACGGGACAGTCAGATCATCCTCATGTCGTTCCTGCAAAAGGTCATGTTCGACGAG
CGCATGACGGAGCTCGAGTACGAAATGTTCAACGGGCTGTGGAAGGTGACGGGCATCTCTCCCGACTACTACGAG
ATCGTCCTCATGGTCGACGCCGACACAAAGGTGTTCCCGGACAGCCTGACGCACATGGTGTCGGCCATGGTCAAG
GATCCCGAGATCATGGGCCTCTGCGGCGAGACCAAGATCGCCAACAAGCGAGACAGCTGGGTGACGGCCATCCAG
GTCTTTGAGTACTTCGTCTCGCACCACCTGGCCAAGTCGTTCGAGAGCGTCTTTGGCGGCGTCACCTGCCTGCCC
GGCTGCTTCTGCATGTACCGCATCAAGGCGCCCAAGGGCGGGCAGAACTACTGGGTTCCCATCCTGGCCAACCCG
GACATCGTCGAGCACTACTCGGAGAACGTGGTCGAGACGCTCCACGAGAAGAACCTGTACCTGCTGGGCGAGGAC
CGCTTCCTGACGACGCTCATGCTACGCACCTTTCCCAAGCGGAAGCAGGTGTTCGTCCCCCAGGCCGTGTGCAAG
ACGACGGTGCCCGACAAGTTCATGGTTCTCCTCTCGCAGCGACGACGCTGGATCAACTCTACCATCCACAACCTG
ATGGAGCTGGTGCTGGTCCGCGATCTTTGCGGCACCTTTTGCTTCAGCATGCAGTTCGTCATATTCGTCGAGCTC
GTCGGCACGCTGGTCTTGCCGGCGGCCATAGCCTTTACCTTTTACGTCGTCATAACCTCCATCGTCCACTCCCCC
CCGCAGATCATCCCCCTCGTCCTCCTCGCCCTCATCCTCGGCCTCCCGGGCGTCCTCATCATCGTGACGGCCCAC
TCGTGGTCGTACGTGATCTGGATGATGATCTACCTCCTCTCCCTCCCCGTCTGGAACTTCGTCCTCCCGACGTAC
GCCTTTTGGAAGTTTGACGATTTCTCGTGGGGGGATACCCGTAAGACGGCCGGCGAGAGCAAGAAGGGTGGCGGG
GGAGGGCACGAAGACGAGGGCGAGTTTGACAGTAGCAAGATTACCATGAAGAGGTGGGCCGAGTTTGAGAGGGAG
AGGAGGATATCACTCTGA
Transcript >Ophcf2|04404
ATGTCGCTGCCAGAGAGGCCCGGCGCCAGTCCTCCCCAGGACCACCGCAGCTCATACAGGCAATCTTCGTCCCGT
CGACTGCCCCCCCTCGACGTCGAAGCGGCCGCCTACCAGGGCTCATCCAGACCCAGACAGCAGCATCATCATCTT
CATCATCAACACGACGTTCCGCTGTCTTCTACTGACCCCGCTGCCCATGACGGCCCATCCTCCTCCGAGCCCTTT
CCCCGCAAGAGGAGCCTCATCAGGCCGGAGAGGACGAGGATCGGAAAGGATCATCGTAACTATCATTACCACAAG
CATGCCGCCAACATGGACGTCCTGCCCTCTTCCACCGGCAACGACCCCATACTCGAGCACCTCGACGGCTCCACC
GAACGATCTGGCGGCTCCCTGCCCAATGGGAGCTTCACCGATTCTCCCCCTCGCCGCAACGACGTAACCGAGCAT
GAAAAGACTCCCGAGCGTACGAGGCCTCGACAGCCCAAGGCGACAAAGATTGCCAAGCCGACAAAGAGAGAGCGG
CGGCCTTCACGTAAGAAGCAAAAGGTGGTGGAGAATCAGCTGAGACCGCCGAGCCTATGGAACGTCTACTGCGCC
ATCATCACCTTTTGGTGCCCCGACTTCATATTGAGATGCTTCGGCAAGCCCACAAAGGCCCAGCGCCGGGCGTGG
AGGGAAAAGATGGGGCTCATCAGCATCATCCTCTTCATCATGGCCATCGTCGGCTTCCTGACCTTTGGCTTCACC
GCCACCGTCTGCCGCGCGCCCCCCCTACGCCTCCGCACCAACGAGGTGTCGGACGGTTACATGATCTTCCACGGC
GTCGCCTACGATCTCGCCAGCTCCCACCACCCTCCCGCCCGGGGCATCCCCCTGCGCCAGGACGGCATGGGCGCC
AACGTCCTCTTCGATCTCCCGGAGAAGCACGGCGGCCAGGACGGGAGCTTCCTCTTCCAAAACGTCAACGGCAAA
TGCAAGGGCGTCATCACCCGGGCTCCGGGCTCCGACGTGCCGTCCAACGCCGCCGACGACCTGGCTTGGTACTTT
CCCTGCACCATCTTCAACCAGGACGGTTCGACTGCGCCCAACCTCACGATCCCCTACTACCTCGGCTATGCCTGC
CACACGACGCAAAACGCCCGTGACGCCTTTTACCGCGGTCTCAACGGCGCCGCCGACGTCTACTTTACTTGGGAC
GACATCAAGAACAGCTCGCGCAACCTCATCGTCTACTCGGGCGCCGTGCTCGACCTCAACCTGCTCAACTGGTTC
AACGAGAGCCAGGTATCCATCCCCGACCGCTTCAAGGAGCTGCGAGACACGCGCAGCGTCGTCAACAGGGCCGTC
CGCGGCCGCGACGTCACGCGCCTGTTCCAGTCGTCGGACGACAAGCGCTACGCCCAGTGCTTCGAGGAGATCATC
AAGGTCGGCTCCGTCGACACCGAGACGGTCGGCTGCATCGCCTCCAAGGTGGTGCTGTACTGCGCCCTCGTCCTG
ATCCTGTCGGTGGTGCTGGCCCGGTTCATGCTGGCCCTCGTCTTCCAGTGGTTCATCAGCCGGAACTACGCCGCT
TCCAAGACGTCGCAGAGCTCCAACCGCAGGAAGCGCAACCAGCAGATCGAGGCCTGGTCCGAGGACATCTACCGC
GCCCCCGCCAGGCTGCCCGGTGACGTGGGCAGCACCGTCGCCAGCTCCAACAAGCGAAGCTCGTCCTTTCTGCCC
ACCACCTCCCGCTTCTCGACAGTCTACGGGGCCGACCGAGGCGGAGGCGGCGGCGGAGGAGGAGGAGACCGAGGA
GGAGGCGGAGGAGGAGGAGGAGGAGTTGGAGGAGGAGGAGGCGCAGGAGGCGGAGGAGGCGGCCATCGACGGATC
CCGACGACCATGACCAGCCAGGGCGCGTCGGGCTCGCTGCTCAGCCCGCACTCCATCTACCGGCACGGCAACGAC
AGCCGGGCGAGCTTCCTCCGGACCGAGACGTTCGGAAGCTCCAACATGGGCGAGGGCCCCGGACCGGCGGGCTTC
ATCCACGACGCCGTCGTGCCGCAGCCGCCGTCGGACTGGATGCCGTTTGGGTTCCCGCTGGCGCACACCATGTGT
CTGGTGACGGCCTACTCGGAGGGCGAAGAGGGCATCCGCACCACGCTAGACTCCATCGCGACGACGGACTACCCC
AACAGCCACAAGGCCATCGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGCGAGGCCGTGTCGACGCCCGAC
GTGTGCCTGGGCATGCTCCGGGACCACTCGACGCCGCCGGAGCTGGTACAGCCCTTCTCGTACGTGGCCGTGGCG
AGCGGATCGAAGCGGCACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTACGGGGCCCGTTCTCAGATCCCC
CCGGACAGGCAGCAGCGCGTGCCCATGATGGTCATCGTCAAGTGCGGCACGCCGGCCGAGGAAGCGGCCAAGTCG
AAGCCGGGCAACCGCGGTAAACGGGACAGTCAGATCATCCTCATGTCGTTCCTGCAAAAGGTCATGTTCGACGAG
CGCATGACGGAGCTCGAGTACGAAATGTTCAACGGGCTGTGGAAGGTGACGGGCATCTCTCCCGACTACTACGAG
ATCGTCCTCATGGTCGACGCCGACACAAAGGTGTTCCCGGACAGCCTGACGCACATGGTGTCGGCCATGGTCAAG
GATCCCGAGATCATGGGCCTCTGCGGCGAGACCAAGATCGCCAACAAGCGAGACAGCTGGGTGACGGCCATCCAG
GTCTTTGAGTACTTCGTCTCGCACCACCTGGCCAAGTCGTTCGAGAGCGTCTTTGGCGGCGTCACCTGCCTGCCC
GGCTGCTTCTGCATGTACCGCATCAAGGCGCCCAAGGGCGGGCAGAACTACTGGGTTCCCATCCTGGCCAACCCG
GACATCGTCGAGCACTACTCGGAGAACGTGGTCGAGACGCTCCACGAGAAGAACCTGTACCTGCTGGGCGAGGAC
CGCTTCCTGACGACGCTCATGCTACGCACCTTTCCCAAGCGGAAGCAGGTGTTCGTCCCCCAGGCCGTGTGCAAG
ACGACGGTGCCCGACAAGTTCATGGTTCTCCTCTCGCAGCGACGACGCTGGATCAACTCTACCATCCACAACCTG
ATGGAGCTGGTGCTGGTCCGCGATCTTTGCGGCACCTTTTGCTTCAGCATGCAGTTCGTCATATTCGTCGAGCTC
GTCGGCACGCTGGTCTTGCCGGCGGCCATAGCCTTTACCTTTTACGTCGTCATAACCTCCATCGTCCACTCCCCC
CCGCAGATCATCCCCCTCGTCCTCCTCGCCCTCATCCTCGGCCTCCCGGGCGTCCTCATCATCGTGACGGCCCAC
TCGTGGTCGTACGTGATCTGGATGATGATCTACCTCCTCTCCCTCCCCGTCTGGAACTTCGTCCTCCCGACGTAC
GCCTTTTGGAAGTTTGACGATTTCTCGTGGGGGGATACCCGTAAGACGGCCGGCGAGAGCAAGAAGGGTGGCGGG
GGAGGGCACGAAGACGAGGGCGAGTTTGACAGTAGCAAGATTACCATGAAGAGGTGGGCCGAGTTTGAGAGGGAG
AGGAGGATATCACTCTGA
Gene >Ophcf2|04404
ATGTCGCTGCCAGAGAGGCCCGGCGCCAGTCCTCCCCAGGACCACCGCAGCTCATACAGGCAATCTTCGTCCCGT
CGACTGCCCCCCCTCGACGTCGAAGCGGCCGCCTACCAGGGCTCATCCAGACCCAGACAGCAGCATCATCATCTT
CATCATCAACGTGGGATTTCCGCATCTTCTTCTCTCGCAGAGACCATCTCCAACCCTAATCACAATGCAGACGAC
GTTCCGCTGTCTTCTACTGACCCCGCTGCCCATGACGGCCCATCCTCCTCCGAGCCCTTTCCCCGCAAGAGGAGC
CTCATCAGGCCGGAGAGGACGAGGATCGGAAAGGATCATCGTAACTATCATTACCACAAGCATGCCGCCAACATG
GACGTCCTGCCCTCTTCCACCGGCAACGACCCCATACTCGAGCACCTCGACGGCTCCACCGAACGATCTGGCGGC
TCCCTGCCCAATGGGAGCTTCACCGATTCTCCCCCTCGCCGCAACGACGTAACCGAGCATGAAAAGACTCCCGAG
CGTACGAGGCCTCGACAGCCCAAGGCGACAAAGATTGCCAAGCCGACAAAGAGAGAGCGGCGGCCTTCACGTAAG
AAGCAAAAGGTGGTGGAGAATCAGCTGAGACCGCCGAGCCTATGGAACGTCTACTGCGCCATCATCACCTTTTGG
TGCCCCGACTTCATATTGAGATGCTTCGGCAAGCCCACAAAGGCCCAGCGCCGGGCGTGGAGGGAAAAGATGGGG
CTCATCAGCATCATCCTCTTCATCATGGCCATCGTCGGCTTCCTGACCTTTGGCTTCACCGCCACCGTCTGCCGC
GCGCCCCCCCTACGCCTCCGCACCAACGAGGTGTCGGACGGTTACATGATCTTCCACGGCGTCGCCTACGATCTC
GCCAGCTCCCACCACCCTCCCGCCCGGGGCATCCCCCTGCGCCAGGACGGCATGGGCGCCAACGTCCTCTTCGAT
CTCCCGGAGAAGCACGGCGGCCAGGACGGGAGCTTCCTCTTCCAAAACGTCAACGGCAAATGCAAGGGCGTCATC
ACCCGGGCTCCGGGCTCCGACGTGCCGTCCAACGCCGCCGACGACCTGGCTTGGTACTTTCCCTGCACCATCTTC
AACCAGGACGGTTCGACTGCGCCCAACCTCACGATCCCCTACTACCTCGGCTATGCCTGCCACACGACGCAAAAC
GCCCGTGACGCCTTTTACCGCGGTCTCAACGGCGCCGCCGACGTCTACTTTACTTGGGACGACATCAAGAACAGC
TCGCGCAACCTCATCGTCTACTCGGGCGCCGTGCTCGACCTCAACCTGCTCAACTGGTTCAACGAGAGCCAGGTA
TCCATCCCCGACCGCTTCAAGGAGCTGCGAGACACGCGCAGCGTCGTCAACAGGGCCGTCCGCGGCCGCGACGTC
ACGCGCCTGTTCCAGTCGTCGGACGACAAGCGCTACGCCCAGTGCTTCGAGGAGATCATCAAGGTCGGCTCCGTC
GACACCGAGACGGTCGGCTGCATCGCCTCCAAGGTGGTGCTGTACTGCGCCCTCGTCCTGATCCTGTCGGTGGTG
CTGGCCCGGTTCATGCTGGCCCTCGTCTTCCAGTGGTTCATCAGCCGGAACTACGCCGCTTCCAAGACGTCGCAG
AGCTCCAACCGCAGGAAGCGCAACCAGCAGATCGAGGCCTGGTCCGAGGACATCTACCGCGCCCCCGCCAGGCTG
CCCGGTGACGTGGGCAGCACCGTCGCCAGCTCCAACAAGCGAAGCTCGTCCTTTCTGCCCACCACCTCCCGCTTC
TCGACAGTCTACGGGGCCGACCGAGGCGGAGGCGGCGGCGGAGGAGGAGGAGACCGAGGAGGAGGCGGAGGAGGA
GGAGGAGGAGTTGGAGGAGGAGGAGGCGCAGGAGGCGGAGGAGGCGGCCATCGACGGATCCCGACGACCATGACC
AGCCAGGGCGCGTCGGGCTCGCTGCTCAGCCCGCACTCCATCTACCGGCACGGCAACGACAGCCGGGCGAGCTTC
CTCCGGACCGAGACGTTCGGAAGCTCCAACATGGGCGAGGGCCCCGGACCGGCGGGCTTCATCCACGACGCCGTC
GTGCCGCAGCCGCCGTCGGACTGGATGCCGTTTGGGTTCCCGCTGGCGCACACCATGTGTCTGGTGACGGCCTAC
TCGGAGGGCGAAGAGGGCATCCGCACCACGCTAGACTCCATCGCGACGACGGACTACCCCAACAGCCACAAGGCC
ATCGTCGTCATCTGCGACGGCATCATCAAGGGCAAGGGCGAGGCCGTGTCGACGCCCGACGTGTGCCTGGGCATG
CTCCGGGACCACTCGACGCCGCCGGAGCTGGTACAGCCCTTCTCGTACGTGGCCGTGGCGAGCGGATCGAAGCGG
CACAACATGGCCAAGGTCTACTGCGGCTTCTACGACTACGGGGCCCGTTCTCAGATCCCCCCGGACAGGCAGCAG
CGCGTGCCCATGATGGTCATCGTCAAGTGCGGCACGCCGGCCGAGGAAGCGGCCAAGTCGAAGCCGGGCAACCGC
GGTAAACGGGACAGTCAGATCATCCTCATGTCGTTCCTGCAAAAGGTCATGTTCGACGAGCGCATGACGGAGCTC
GAGTACGAAATGTTCAACGGGCTGTGGAAGGTGACGGGCATCTCTCCCGACTACTACGAGATCGTCCTCATGGTC
GACGCCGACACAAAGGTGTTCCCGGACAGCCTGACGCACATGGTGTCGGCCATGGTCAAGGATCCCGAGATCATG
GGCCTCTGCGGCGAGACCAAGATCGCCAACAAGCGAGACAGCTGGGTGACGGCCATCCAGGTCTTTGAGTACTTC
GTCTCGCACCACCTGGCCAAGTCGTTCGAGAGCGTCTTTGGCGGCGTCACCTGCCTGCCCGGCTGCTTCTGCATG
TACCGCATCAAGGCGCCCAAGGGCGGGCAGAACTACTGGGTTCCCATCCTGGCCAACCCGGACATCGTCGAGCAC
TACTCGGAGAACGTGGTCGAGACGCTCCACGAGAAGAACCTGTACCTGCTGGGCGAGGACCGCTTCCTGACGACG
CTCATGCTACGCACCTTTCCCAAGCGGAAGCAGGTGTTCGTCCCCCAGGCCGTGTGCAAGACGACGGTGCCCGAC
AAGTTCATGGTTCTCCTCTCGCAGCGACGACGCTGGATCAACTCTACCATCCACAACCTGATGGAGCTGGTGCTG
GTCCGCGATCTTTGCGGCACCTTTTGCTTCAGCATGCAGTTCGTCATATTCGTCGAGCTCGTCGGCACGCTGGTC
TTGCCGGCGGCCATAGCCTTTACCTTTTACGTCGGTGAGTCTTCGTTCTCGGCTGGAAAAAAAAAAAAAAAAAAC
TCAGGTCCGAGTCCTAACGAGAGAGCCAGTCATAACCTCCATCGTCCACTCCCCCCCGCAGATCATCCCCCTCGT
CCTCCTCGCCCTCATCCTCGGCCTCCCGGGCGTCCTCATCATCGTGACGGCCCACTCGTGGTCGTACGTGATCTG
GATGATGATCTACCTCCTCTCCCTCCCCGTCTGGAACTTCGTCCTCCCGACGTACGCCTTTTGGAAGTTTGACGA
TTTCTCGTGGGGGGATACCCGTAAGACGGCCGGCGAGAGCAAGAAGGGTGGCGGGGGAGGGCACGAAGACGAGGG
CGAGTTTGACAGTAGCAAGATTACCATGAAGAGGTGGGCCGAGTTTGAGAGGGAGAGGAGGAGTAGGAGTGCTTC
TTATTGGGGGGGGAGGGGGAATGGGCTGTTTCGCCGGGGCATTTTCACGATGAGTATCACTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail