Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04400
Gene name
Locationscaffold_04:3146573..3147192
Strand-
Gene length (bp)619
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09446 VMA21 VMA21-like domain 9.3E-15 80 135

GO

GO Term Description Terminal node
GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly Yes
GO:0043933 protein-containing complex organization No
GO:0071840 cellular component organization or biogenesis No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0070070 proton-transporting V-type ATPase complex assembly No
GO:0009987 cellular process No
GO:0022607 cellular component assembly No
GO:0016043 cellular component organization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22
2 114 136 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 69.21 31.23 107.19
Alive In ants, during behavior modification 138.13 70.82 205.45
Dead In ants, recently dead 100.47 49.26 151.68

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.001409 yes
Alive Dead 0.089776 no
Dead Fungus 0.121387 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04400
MYYIATTKHRHPQSHHLVLPHHVPSIPQPSSPQHHQSSLTTQILTSQLQWQPAASPLNPPPPSPPTPSSPSNISP
AVPKHVIVKLLAFTLAMIVLPIGSYFITVDTVFKGNSSYAGGFAALLANVVLIAYVIVAMNEDQSDTKSTRKSEG
KKDQ*
Coding >Ophcf2|04400
ATGTACTACATCGCAACTACCAAGCATCGCCACCCTCAATCCCATCACCTTGTCCTCCCCCATCACGTGCCCTCA
ATCCCTCAACCATCATCCCCTCAACACCACCAATCCTCCCTCACCACCCAAATCCTCACCTCACAACTCCAATGG
CAACCCGCCGCATCCCCCCTCAACCCCCCCCCTCCTTCCCCCCCAACCCCATCCTCCCCCTCAAACATCTCCCCC
GCGGTCCCCAAACATGTCATCGTCAAGCTGCTCGCCTTCACACTCGCCATGATCGTCCTCCCCATCGGCTCCTAC
TTCATCACCGTCGACACCGTCTTCAAGGGCAACTCCTCATACGCTGGCGGCTTCGCTGCCCTGCTGGCCAACGTC
GTGCTCATCGCCTACGTCATCGTCGCTATGAACGAGGATCAGTCGGATACAAAGTCGACGAGGAAATCCGAGGGC
AAAAAGGATCAATGA
Transcript >Ophcf2|04400
ATGTACTACATCGCAACTACCAAGCATCGCCACCCTCAATCCCATCACCTTGTCCTCCCCCATCACGTGCCCTCA
ATCCCTCAACCATCATCCCCTCAACACCACCAATCCTCCCTCACCACCCAAATCCTCACCTCACAACTCCAATGG
CAACCCGCCGCATCCCCCCTCAACCCCCCCCCTCCTTCCCCCCCAACCCCATCCTCCCCCTCAAACATCTCCCCC
GCGGTCCCCAAACATGTCATCGTCAAGCTGCTCGCCTTCACACTCGCCATGATCGTCCTCCCCATCGGCTCCTAC
TTCATCACCGTCGACACCGTCTTCAAGGGCAACTCCTCATACGCTGGCGGCTTCGCTGCCCTGCTGGCCAACGTC
GTGCTCATCGCCTACGTCATCGTCGCTATGAACGAGGATCAGTCGGATACAAAGTCGACGAGGAAATCCGAGGGC
AAAAAGGATCAATGA
Gene >Ophcf2|04400
ATGTACTACATCGCAACTACCAAGCATCGCCACCCTCAATCCCATCACCTTGTGTCAGCCTGTCACAATTCCTCA
ATTCTCCCCTCACGTGACTACAGCCTCCCCCATCACGTGCCCTCAATCCCTCAACCATCATCCCCTCAACACCAC
CAATCCTCCCTCACCACCCAAATCCTCACCTCACAACTCCAATGGCAACCCGCCGCATCCCCCCTCAACCCCCCC
CCTCCTTCCCCCCCAACCCCATCCTCCCCCTCAAACATCTCCCCCGCGGTCCCCAAGTAAATACCCTTTTACCCC
CCCCCCCCTTCTATTCACCGAGGCTGACCATCAGACATGTCATCGTCAAGCTGCTCGCCTTCACACTCGCCATGA
TCGTCCTCCCCATCGGCTCCTACTTCATCACCGTCGACACCGTCTTCAAGGGTGAATCTCTTCCATGCCTCTAAC
ACTTGATGCGCTGTTCCGGCTGACTCCATTAGGCAACTCCTCATACGCTGGCGGCTTCGCTGCCCTGCTGGCCAA
CGTCGTGCTCATCGCCTACGTCATCGTCGCTATGAACGAGGATCAGTCGGATACAAAGTCGACGAGGAAATCCGA
GGGCAAAAAGGATCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail