Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04394
Gene name
Locationscaffold_04:3129311..3131212
Strand+
Gene length (bp)1901
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.7E-11 49 115
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.4E-07 54 143
PF01266 DAO FAD dependent oxidoreductase 1.5E-06 47 84

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 290 312 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04394
MSPLSVRVRVPNSKSPGSRMLSNNVGTRYATTTTTTTTTTASPGRRIAIIGGGLTGLTTAYRLACTQPSSTRITI
YEASPRLGGWIRSDEADVDVGGVQGKVRFERGPRTLSSLSGSSWRFDDLGLYHLVTRLGVEVVFPKETARFLVGG
DGGLEKVPETVLEACSTRFARRCWGAVPGFALQRLLRGRGGIPDDESVSSWLRSVTMSDPVTDVASAMIQGIYGG
DITRLSARHVLSGMYYRYHLRRPPRGKVVMPASEREFLRSEDDGGIIVIDTVSIINTIVITINTIIIINIITITI
TITITITITIIITTITTTTTTTTTTTTTTITIPTPTTINTPPLRQSHRHHPPHSLSPLTPNLPTLSHLPSVTVTT
VNLWYPRPNLHPPGLGYLIARHAPNPERALGVFFDSAVGVSLGHEPAGSKLFVLLGGHLHDDALHGGSQAIPLAK
KMLSRHLAIPPDEECHAQVNMARDCIPQPVVGRDALLDRLGREMRSGFGGALAVAGGAYSRVGALAAIRAGFDVV
EDLGRDWGRRASGAWRRGGLWRLRGRGWGCEAWEVVS*
Coding >Ophcf2|04394
ATGTCTCCTCTCAGCGTCAGGGTCCGCGTCCCAAACAGCAAGAGTCCCGGTAGCCGAATGCTCTCAAACAATGTC
GGAACCCGATACGCAACAACAACAACAACAACAACAACAACAACAGCCAGTCCGGGACGCCGAATCGCCATCATC
GGCGGGGGTCTAACAGGTCTAACGACAGCATACCGCCTGGCCTGCACGCAACCGTCCTCGACAAGGATAACCATC
TACGAAGCCTCCCCGCGTCTGGGAGGCTGGATCCGCAGCGACGAAGCCGACGTGGACGTAGGCGGGGTCCAGGGC
AAGGTCAGATTCGAGCGCGGGCCGCGGACGCTATCCTCGCTGTCCGGGAGTTCGTGGCGGTTCGATGACCTGGGG
CTATACCATCTCGTCACGAGGCTGGGGGTGGAGGTTGTGTTCCCCAAGGAGACGGCTAGGTTTCTCGTCGGGGGG
GATGGCGGGTTGGAGAAGGTTCCCGAGACGGTTTTGGAGGCTTGCTCTACGAGGTTTGCCAGACGGTGTTGGGGG
GCCGTTCCCGGATTCGCGCTGCAGAGATTGTTGAGGGGGAGGGGAGGGATTCCGGACGATGAGTCGGTTTCCTCC
TGGCTGCGATCTGTAACCATGAGCGACCCCGTCACGGACGTAGCCTCGGCCATGATACAGGGCATCTACGGCGGA
GACATAACCCGACTCAGCGCCCGGCACGTCCTCTCCGGGATGTACTACCGCTATCATCTCCGTCGACCGCCGCGG
GGGAAAGTGGTGATGCCGGCTTCGGAGAGGGAGTTTCTGAGGAGCGAGGACGACGGCGGCATCATTGTCATCGAC
ACCGTCAGTATTATCAACACCATCGTCATCACTATCAACACCATCATCATCATCAACATCATCACCATCACCATC
ACCATCACCATCACCATCACCATCACCATCATCATCACCACCATCACCACCACCACCACCACCACCACCACCACC
ACCACCACCACCATCACAATCCCCACCCCAACAACAATCAACACACCACCCCTACGACAAAGTCATCGCCACCAT
CCCCCCCATTCCCTCTCCCCCCTAACCCCCAACCTCCCAACCCTCTCCCACCTCCCCTCCGTCACCGTCACGACC
GTCAACCTCTGGTACCCGCGACCGAACCTCCACCCTCCAGGCCTAGGCTACCTGATAGCACGCCACGCGCCCAAC
CCAGAGCGAGCCCTCGGAGTCTTCTTCGATTCCGCCGTCGGAGTCTCCCTCGGCCACGAACCGGCCGGCTCCAAA
CTCTTCGTCCTCCTCGGCGGTCATCTCCACGACGATGCCCTCCACGGCGGATCCCAAGCCATCCCTCTGGCCAAG
AAGATGCTCTCCCGTCATCTAGCCATCCCCCCCGACGAAGAATGCCACGCCCAGGTCAACATGGCCCGTGACTGC
ATCCCGCAACCGGTCGTCGGTCGCGACGCCCTCCTCGACCGGCTGGGCCGGGAGATGCGCTCCGGCTTCGGCGGC
GCTCTGGCCGTCGCCGGCGGCGCCTATTCCAGGGTCGGCGCCCTGGCGGCTATAAGGGCCGGCTTTGATGTCGTG
GAGGATTTGGGGCGGGATTGGGGGCGACGGGCATCCGGGGCTTGGAGGAGGGGGGGTTTGTGGAGGTTGAGGGGC
CGAGGTTGGGGCTGTGAGGCCTGGGAGGTGGTGAGTTGA
Transcript >Ophcf2|04394
ATGTCTCCTCTCAGCGTCAGGGTCCGCGTCCCAAACAGCAAGAGTCCCGGTAGCCGAATGCTCTCAAACAATGTC
GGAACCCGATACGCAACAACAACAACAACAACAACAACAACAACAGCCAGTCCGGGACGCCGAATCGCCATCATC
GGCGGGGGTCTAACAGGTCTAACGACAGCATACCGCCTGGCCTGCACGCAACCGTCCTCGACAAGGATAACCATC
TACGAAGCCTCCCCGCGTCTGGGAGGCTGGATCCGCAGCGACGAAGCCGACGTGGACGTAGGCGGGGTCCAGGGC
AAGGTCAGATTCGAGCGCGGGCCGCGGACGCTATCCTCGCTGTCCGGGAGTTCGTGGCGGTTCGATGACCTGGGG
CTATACCATCTCGTCACGAGGCTGGGGGTGGAGGTTGTGTTCCCCAAGGAGACGGCTAGGTTTCTCGTCGGGGGG
GATGGCGGGTTGGAGAAGGTTCCCGAGACGGTTTTGGAGGCTTGCTCTACGAGGTTTGCCAGACGGTGTTGGGGG
GCCGTTCCCGGATTCGCGCTGCAGAGATTGTTGAGGGGGAGGGGAGGGATTCCGGACGATGAGTCGGTTTCCTCC
TGGCTGCGATCTGTAACCATGAGCGACCCCGTCACGGACGTAGCCTCGGCCATGATACAGGGCATCTACGGCGGA
GACATAACCCGACTCAGCGCCCGGCACGTCCTCTCCGGGATGTACTACCGCTATCATCTCCGTCGACCGCCGCGG
GGGAAAGTGGTGATGCCGGCTTCGGAGAGGGAGTTTCTGAGGAGCGAGGACGACGGCGGCATCATTGTCATCGAC
ACCGTCAGTATTATCAACACCATCGTCATCACTATCAACACCATCATCATCATCAACATCATCACCATCACCATC
ACCATCACCATCACCATCACCATCACCATCATCATCACCACCATCACCACCACCACCACCACCACCACCACCACC
ACCACCACCACCATCACAATCCCCACCCCAACAACAATCAACACACCACCCCTACGACAAAGTCATCGCCACCAT
CCCCCCCATTCCCTCTCCCCCCTAACCCCCAACCTCCCAACCCTCTCCCACCTCCCCTCCGTCACCGTCACGACC
GTCAACCTCTGGTACCCGCGACCGAACCTCCACCCTCCAGGCCTAGGCTACCTGATAGCACGCCACGCGCCCAAC
CCAGAGCGAGCCCTCGGAGTCTTCTTCGATTCCGCCGTCGGAGTCTCCCTCGGCCACGAACCGGCCGGCTCCAAA
CTCTTCGTCCTCCTCGGCGGTCATCTCCACGACGATGCCCTCCACGGCGGATCCCAAGCCATCCCTCTGGCCAAG
AAGATGCTCTCCCGTCATCTAGCCATCCCCCCCGACGAAGAATGCCACGCCCAGGTCAACATGGCCCGTGACTGC
ATCCCGCAACCGGTCGTCGGTCGCGACGCCCTCCTCGACCGGCTGGGCCGGGAGATGCGCTCCGGCTTCGGCGGC
GCTCTGGCCGTCGCCGGCGGCGCCTATTCCAGGGTCGGCGCCCTGGCGGCTATAAGGGCCGGCTTTGATGTCGTG
GAGGATTTGGGGCGGGATTGGGGGCGACGGGCATCCGGGGCTTGGAGGAGGGGGGGTTTGTGGAGGTTGAGGGGC
CGAGGTTGGGGCTGTGAGGCCTGGGAGGTGGTGAGTTGA
Gene >Ophcf2|04394
ATGTCTCCTCTCAGCGTCAGGGTCCGCGTCCCAAACAGCAAGAGTCCCGGTAGCCGAATGCTCTCAAACAATGTC
GGAACCCGATACGCAACAACAACAACAACAACAACAACAACAACAGCCAGTCCGGGACGCCGAATCGCCATCATC
GGCGGGGGTCTAACAGGTCTAACGACAGCATACCGCCTGGCCTGCACGCAACCGTCCTCGACAAGGATAACCATC
TACGAAGCCTCCCCGCGTCTGGGAGGCTGGATCCGCAGCGACGAAGCCGACGTGGACGTAGGCGGGGTCCAGGGC
AAGGTCAGATTCGAGCGCGGGCCGCGGACGCTATCCTCGCTGTCCGGGAGTTCGTGGCGGTTCGATGACCTGGGG
CTATACCATCTCGTCACGAGGCTGGGGGTGGAGGTTGTGTTCCCCAAGGAGACGGCTAGGTTTCTCGTCGGGGGG
GATGGCGGGTTGGAGAAGGTTCCCGAGACGGTTTTGGAGGCTTGCTCTACGAGGTTTGCCAGACGGTGTTGGGGG
GCCGTTCCCGGATTCGCGCTGCAGAGATTGTTGAGGGGGAGGGGAGGGATTCCGGACGATGAGTCGGTTTCCTCC
TGGCTGCGATCTGTAACCATGAGCGACCCCGTCACGGACGTAGCCTCGGCCATGATACAGGGCATCTACGGCGGA
GACATAACCCGACTCAGCGCCCGGCACGTCCTCTCCGGGATGTACTACCGCTATCATCTCCGTCGACCGCCGCGG
GGGAAAGTGGTGATGCCGGCTTCGGAGAGGGAGTTTCTGAGGAGGTGGGGGGGGACGAGGAGGTTGGGAGGTTGG
CCAGGGGGAGAAGGGCTCTCTGCTGCATTTTGGGGGGGGGGGTTTGGAGGCGCTTGTTAGGGCTTTGGCGGGGGA
CTTGGAGGGGAGGCGGAATGTGGAGGTTAGGAGGGGGGTTGTTGTTGAGGGGGTTGGCTTTGAGGGGGGGGTTGC
GGTTGTGAGGGCGAGGGGGGGGGGGCAGCAGCGAGGACGACGGCGGCATCATTGTCATCGACACCGTCAGTATTA
TCAACACCATCGTCATCACTATCAACACCATCATCATCATCAACATCATCACCATCACCATCACCATCACCATCA
CCATCACCATCACCATCATCATCACCACCATCACCACCACCACCACCACCACCACCACCACCACCACCACCACCA
TCACAATCCCCACCCCAACAACAATCAACACACCACCCCTACGACAAAGTCATCGCCACCATCCCCCCCATTCCC
TCTCCCCCCTAACCCCCAACCTCCCAACCCTCTCCCACCTCCCCTCCGTCACCGTCACGACCGTCAACCTCTGGT
ACCCGCGACCGAACCTCCACCCTCCAGGCCTAGGCTACCTGATAGCACGCCACGCGCCCAACCCAGAGCGAGCCC
TCGGAGTCTTCTTCGATTCCGCCGTCGGAGTCTCCCTCGGCCACGAACCGGCCGGCTCCAAACTCTTCGTCCTCC
TCGGCGGTCATCTCCACGACGATGCCCTCCACGGCGGATCCCAAGCCATCCCTCTGGCCAAGAAGATGCTCTCCC
GTCATCTAGCCATCCCCCCCGACGAAGAATGCCACGCCCAGGTCAACATGGCCCGTGACTGCATCCCGCAACCGG
TCGTCGGTCGCGACGCCCTCCTCGACCGGCTGGGCCGGGAGATGCGCTCCGGCTTCGGCGGCGCTCTGGCCGTCG
CCGGCGGCGCCTATTCCAGGGTCGGCGCCCTGGCGGCTATAAGGGCCGGCTTTGATGTCGTGGAGGATTTGGGGC
GGGATTGGGGGCGACGGGCATCCGGGGCTTGGAGGAGGGGGGGTTTGTGGAGGTTGAGGGGCCGAGGTTGGGGCT
GTGAGGCCTGGGAGGTGGTGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail