Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04392
Gene name
Locationscaffold_04:3123957..3125838
Strand-
Gene length (bp)1881
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 2.1E-91 195 534
PF14845 Glycohydro_20b2 beta-acetyl hexosaminidase like 9.5E-29 23 170

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1428 0.0687 0.8763 0.1598 0.0997 0.1708 0.4517 0.4518 0.2727 0.0094

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999767

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH20 4.2E-87 190 534

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup299
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3143
Ophiocordyceps australis map64 (Brazil) OphauB2|2608
Ophiocordyceps australis map64 (Brazil) OphauB2|7170
Ophiocordyceps camponoti-floridani Ophcf2|04392 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06719
Ophiocordyceps camponoti-rufipedis Ophun1|3912
Ophiocordyceps kimflemingae Ophio5|3678
Ophiocordyceps kimflemingae Ophio5|5955
Ophiocordyceps subramaniannii Hirsu2|10290
Ophiocordyceps subramaniannii Hirsu2|5838

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04392
MVISLAALALVAVVVTPDAAYALWPAPQKLSTGNSVLFIDEGVKVTYNGRPLSSSTDYTSPKSGPDFSSEEIVQS
AVSRALKAIFKDNFVPWKLRARHSDFEPEPRKDGKLSIKSIDIFQTQADSQRTFKPRAGDVNESYGLDVSRDGQV
ELRCKSSTGCLHGLETLVQLFFQHSAGDCWYTPHAPISIRDAPQYPHRGVLLDLSRMWYPLTDVRRTIDAMAWSK
MNRLHLHMTDSQSWPLEVPALPRLAEKGAYRKGLSYSPADIAALYEYAIHRGVSIILEIDMPGHLGVVDLAYKDL
IVAYNQKPFQWFCAEPPCGAFRLNSPEVYDFLDKLLGDVLPRVASYSSYFHTGGDELNKNDSKLDPGVGSNDAAV
IKPLLQKFINHAHEKVRKAGLTPLVWEEMATEWNQTLGSDVIVQSWLGNGAVEKLAKAGHKVIDSDYSFWYLDCG
RGQWLNFDNGPAFQRYYPFNDWCSPTKSWRLVYSHDPRAGLSPAEADLVLGGEVAIWSELTDSTNIDSVIWPRAS
AAGEVLWSGRQDSSGKNRSQYDAAPRLAEFRERMVARGVAAMPVQMVFCTQGGPEECAMTVD*
Coding >Ophcf2|04392
ATGGTCATCTCTCTGGCAGCTCTCGCTTTGGTGGCCGTCGTCGTCACCCCAGACGCGGCTTACGCCCTGTGGCCC
GCTCCGCAGAAGTTGTCGACGGGGAACTCAGTGCTGTTTATCGACGAGGGTGTCAAGGTCACGTACAATGGACGT
CCTCTATCATCCAGTACCGATTACACCAGCCCCAAGTCGGGCCCCGACTTTAGCAGCGAGGAAATCGTTCAGTCA
GCCGTGTCTCGCGCTTTGAAAGCCATCTTCAAAGACAACTTTGTGCCGTGGAAGCTACGAGCGCGCCACTCCGAC
TTCGAGCCCGAGCCTCGGAAGGATGGGAAGCTTAGCATCAAGTCCATCGACATCTTCCAGACGCAAGCCGATAGC
CAGCGGACCTTTAAGCCCCGCGCAGGAGATGTGAATGAGTCGTACGGGCTCGACGTCTCGCGCGACGGCCAGGTC
GAGTTGCGGTGCAAGTCGTCGACGGGCTGTCTGCACGGGCTGGAGACGCTGGTGCAACTCTTCTTCCAGCACAGC
GCCGGGGACTGCTGGTATACGCCGCATGCGCCCATCTCGATCCGGGACGCGCCGCAGTATCCTCACAGGGGTGTT
CTTCTCGATCTGTCGCGCATGTGGTACCCGCTCACGGACGTGCGGAGGACCATCGACGCCATGGCCTGGAGCAAG
ATGAATCGTCTGCATCTACACATGACGGACTCTCAGTCGTGGCCGCTCGAGGTTCCTGCGCTGCCGCGGCTGGCG
GAAAAGGGAGCGTATAGGAAGGGTCTTTCATACTCGCCGGCTGATATCGCGGCTTTATATGAGTACGCCATCCAC
CGCGGCGTGTCCATCATCCTCGAAATCGACATGCCCGGTCACCTTGGCGTCGTCGACCTCGCGTACAAGGACCTC
ATCGTCGCCTACAACCAGAAACCCTTTCAGTGGTTCTGCGCCGAACCACCTTGCGGAGCGTTCCGGCTGAACAGC
CCCGAGGTGTACGACTTTCTCGATAAGCTATTGGGCGATGTCCTGCCTCGAGTCGCCTCCTACTCGTCCTACTTT
CACACCGGCGGTGACGAGCTGAATAAGAACGACTCTAAGCTCGACCCGGGCGTCGGCTCTAACGATGCGGCTGTG
ATCAAACCGCTTCTACAAAAGTTCATCAACCACGCGCACGAAAAGGTTCGCAAGGCCGGACTAACTCCTCTGGTA
TGGGAGGAGATGGCGACCGAGTGGAATCAGACGCTGGGTTCAGACGTCATCGTCCAGTCGTGGCTGGGCAACGGA
GCAGTCGAGAAGCTAGCCAAAGCAGGACACAAGGTGATAGACAGCGACTACAGCTTCTGGTATCTCGACTGCGGC
CGCGGCCAATGGCTCAACTTTGACAACGGCCCTGCCTTTCAGCGCTACTACCCTTTCAACGACTGGTGCTCGCCA
ACCAAGAGCTGGCGGCTCGTCTACTCTCACGATCCGCGAGCCGGCCTCTCGCCCGCCGAAGCCGACCTCGTCCTC
GGCGGCGAGGTTGCCATCTGGAGCGAGCTAACCGACAGCACCAACATAGACAGCGTCATCTGGCCACGAGCCAGT
GCTGCAGGAGAAGTGCTCTGGTCCGGAAGGCAGGACTCTTCCGGGAAGAACCGAAGCCAGTACGATGCGGCTCCG
CGACTGGCCGAGTTCAGGGAGAGGATGGTGGCGCGGGGCGTGGCGGCGATGCCGGTGCAGATGGTGTTTTGCACG
CAGGGGGGTCCCGAGGAGTGTGCCATGACGGTTGATTGA
Transcript >Ophcf2|04392
ATGGTCATCTCTCTGGCAGCTCTCGCTTTGGTGGCCGTCGTCGTCACCCCAGACGCGGCTTACGCCCTGTGGCCC
GCTCCGCAGAAGTTGTCGACGGGGAACTCAGTGCTGTTTATCGACGAGGGTGTCAAGGTCACGTACAATGGACGT
CCTCTATCATCCAGTACCGATTACACCAGCCCCAAGTCGGGCCCCGACTTTAGCAGCGAGGAAATCGTTCAGTCA
GCCGTGTCTCGCGCTTTGAAAGCCATCTTCAAAGACAACTTTGTGCCGTGGAAGCTACGAGCGCGCCACTCCGAC
TTCGAGCCCGAGCCTCGGAAGGATGGGAAGCTTAGCATCAAGTCCATCGACATCTTCCAGACGCAAGCCGATAGC
CAGCGGACCTTTAAGCCCCGCGCAGGAGATGTGAATGAGTCGTACGGGCTCGACGTCTCGCGCGACGGCCAGGTC
GAGTTGCGGTGCAAGTCGTCGACGGGCTGTCTGCACGGGCTGGAGACGCTGGTGCAACTCTTCTTCCAGCACAGC
GCCGGGGACTGCTGGTATACGCCGCATGCGCCCATCTCGATCCGGGACGCGCCGCAGTATCCTCACAGGGGTGTT
CTTCTCGATCTGTCGCGCATGTGGTACCCGCTCACGGACGTGCGGAGGACCATCGACGCCATGGCCTGGAGCAAG
ATGAATCGTCTGCATCTACACATGACGGACTCTCAGTCGTGGCCGCTCGAGGTTCCTGCGCTGCCGCGGCTGGCG
GAAAAGGGAGCGTATAGGAAGGGTCTTTCATACTCGCCGGCTGATATCGCGGCTTTATATGAGTACGCCATCCAC
CGCGGCGTGTCCATCATCCTCGAAATCGACATGCCCGGTCACCTTGGCGTCGTCGACCTCGCGTACAAGGACCTC
ATCGTCGCCTACAACCAGAAACCCTTTCAGTGGTTCTGCGCCGAACCACCTTGCGGAGCGTTCCGGCTGAACAGC
CCCGAGGTGTACGACTTTCTCGATAAGCTATTGGGCGATGTCCTGCCTCGAGTCGCCTCCTACTCGTCCTACTTT
CACACCGGCGGTGACGAGCTGAATAAGAACGACTCTAAGCTCGACCCGGGCGTCGGCTCTAACGATGCGGCTGTG
ATCAAACCGCTTCTACAAAAGTTCATCAACCACGCGCACGAAAAGGTTCGCAAGGCCGGACTAACTCCTCTGGTA
TGGGAGGAGATGGCGACCGAGTGGAATCAGACGCTGGGTTCAGACGTCATCGTCCAGTCGTGGCTGGGCAACGGA
GCAGTCGAGAAGCTAGCCAAAGCAGGACACAAGGTGATAGACAGCGACTACAGCTTCTGGTATCTCGACTGCGGC
CGCGGCCAATGGCTCAACTTTGACAACGGCCCTGCCTTTCAGCGCTACTACCCTTTCAACGACTGGTGCTCGCCA
ACCAAGAGCTGGCGGCTCGTCTACTCTCACGATCCGCGAGCCGGCCTCTCGCCCGCCGAAGCCGACCTCGTCCTC
GGCGGCGAGGTTGCCATCTGGAGCGAGCTAACCGACAGCACCAACATAGACAGCGTCATCTGGCCACGAGCCAGT
GCTGCAGGAGAAGTGCTCTGGTCCGGAAGGCAGGACTCTTCCGGGAAGAACCGAAGCCAGTACGATGCGGCTCCG
CGACTGGCCGAGTTCAGGGAGAGGATGGTGGCGCGGGGCGTGGCGGCGATGCCGGTGCAGATGGTGTTTTGCACG
CAGGGGGGTCCCGAGGAGTGTGCCATGACGGTTGATTGA
Gene >Ophcf2|04392
ATGGTCATCTCTCTGGCAGCTCTCGCTTTGGTGGCCGTCGTCGTCACCCCAGACGCGGCTTACGCCCTGTGGCCC
GCTCCGCAGAAGTTGTCGACGGGGAACTCAGTGCTGTTTATCGACGAGGGTGTCAAGGTCACGTACAATGGACGT
CCTGTACGTTGCCTCCCCCTTGCATACATTCACCGACTCCAAGCTGACGGCCAAAGCTATCATCCAGTACCGATT
ACACCAGCCCCAAGTCGGGCCCCGACTTTAGCAGCGAGGAAATCGTTCAGTCAGCCGTGTCTCGCGCTTTGAAAG
CCATCTTCAAAGACAACTTTGTGCCGTGGAAGCTACGAGCGCGCCACTCCGACTTCGAGCCCGAGCCTCGGAAGG
ATGGGAAGCTTAGCATCAAGTCCATCGACATCTTCCAGACGCAAGCCGATAGCCAGCGGACCTTTAAGCCCCGCG
CAGGAGATGTGAATGAGTCGTACGGGCTCGACGTCTCGCGCGACGGCCAGGTCGAGTTGCGGTGCAAGTCGTCGA
CGGGCTGTCTGCACGGGCTGGAGACGCTGGTGCAACTCTTCTTCCAGCACAGCGCCGGGGACTGCTGGTATACGC
CGCATGCGCCCATCTCGATCCGGGACGCGCCGCAGTATCCTCACAGGGGTGTTCTTCTCGATCTGTCGCGCATGT
GGTACCCGCTCACGGACGTGCGGAGGACCATCGACGCCATGGCCTGGAGCAAGATGAATCGTCTGCATCTACACA
TGACGGACTCTCAGTCGTGGCCGCTCGAGGTTCCTGCGCTGCCGCGGCTGGCGGAAAAGGGAGCGTATAGGAAGG
GTCTTTCATACTCGCCGGCTGATATCGCGGCTTTATATGAGTACGCCATCCACCGCGGCGTGTCCATCATCCTCG
AAATCGACATGCCCGGTCACCTTGGCGTCGTCGACCTCGCGTACAAGGACCTCATCGTCGCCTACAACCAGAAAC
CCTTTCAGTGGTTCTGCGCCGAACCACCTTGCGGAGCGTTCCGGCTGAACAGCCCCGAGGTGTACGACTTTCTCG
ATAAGCTATTGGGCGATGTCCTGCCTCGAGTCGCCTCCTACTCGTCCTACTTTCACACCGGCGGTGACGAGCTGA
ATAAGAACGACTCTAAGCTCGACCCGGGCGTCGGCTCTAACGATGCGGCTGTGATCAAACCGCTTCTACAAAAGT
TCATCAACCACGCGCACGAAAAGGTTCGCAAGGCCGGACTAACTCCTCTGGTATGGGAGGAGATGGCGACCGAGT
GGAATCAGACGCTGGGTTCAGACGTCATCGTCCAGTCGTGGCTGGGCAACGGAGCAGTCGAGAAGCTAGCCAAAG
CAGGACACAAGGTGATAGACAGCGACTACAGCTTCTGGGTGAGCACGCCACGATGAAGAATGAAGAAAGAGGGAC
TCGGCTAACAGGGCTGGCTGGTGGCAGTATCTCGACTGCGGCCGCGGCCAATGGCTCAACTTTGACAACGGCCCT
GCCTTTCAGCGCTACTACCCTTTCAACGACTGGTGCTCGCCAACCAAGAGCTGGCGGCTCGTCTACTCTCACGAT
CCGCGAGCCGGCCTCTCGCCCGCCGAAGCCGACCTCGTCCTCGGCGGCGAGGTTGCCATCTGGAGCGAGCTAACC
GACAGCACCAACATAGACAGCGTCATCTGGCCACGAGCCAGTGCTGCAGGAGAAGTGCTCTGGTCCGGAAGGCAG
GACTCTTCCGGGAAGAACCGAAGCCAGTACGATGCGGCTCCGCGACTGGCCGAGTTCAGGGAGAGGATGGTGGCG
CGGGGCGTGGCGGCGATGCCGGTGCAGATGGTGTTTTGCACGCAGGGGGGTCCCGAGGAGTGTGCCATGACGGTT
GATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail