Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04388
Gene name
Locationscaffold_04:3113515..3114481
Strand-
Gene length (bp)966
Transcript length (bp)744
Coding sequence length (bp)744
Protein length (aa) 248

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01214 CK_II_beta Casein kinase II regulatory subunit 1.3E-74 16 195

GO

GO Term Description Terminal node
GO:0019887 protein kinase regulator activity Yes
GO:0005956 protein kinase CK2 complex Yes
GO:0005575 cellular_component No
GO:0019207 kinase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0032991 protein-containing complex No
GO:0140535 intracellular protein-containing complex No
GO:0003674 molecular_function No
GO:0030234 enzyme regulator activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.7181 0.713 0.0338 0.0313 0.2145 0.0017 0.0563 0.0978 0.0631 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6022
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3140
Ophiocordyceps australis map64 (Brazil) OphauB2|2605
Ophiocordyceps camponoti-floridani Ophcf2|04388 (this protein)
Ophiocordyceps kimflemingae Ophio5|5959
Ophiocordyceps subramaniannii Hirsu2|11234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04388
MDDYVSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLITEVQYYQYALDLVTDVFDLDCDDEMRET
IEKSARHLYGLVHARYIVTTRGLTKMLDKYKKAEFGKCPRVNCHSHPLLPMGLSDVPNAKAVKLYCARCEDIYNP
KSSRHAAIDGAYFGTSFHNIIFQVYPALVPSKLVDRYVPRVYGFKVHASAALVRWQNARRDAMRRRLRRLEIDSG
FKEEMPVEDQDVQDVEIEGAFD*
Coding >Ophcf2|04388
ATGGACGACTACGTTAGCGAATCCGATAGCGACTATACCAGTTACTGGCGTGACTGGTTTATATCATCCCGAGGA
AACGAGTATTTCTGCGAAATCGACGAGGATTATCTCACTGATCGATTTAACCTAACGGGTCTCATTACAGAAGTG
CAATACTATCAATATGCACTTGACCTTGTCACCGATGTCTTTGACCTCGATTGCGATGATGAGATGCGCGAGACG
ATTGAGAAATCTGCTCGTCATCTATACGGTCTCGTTCACGCCCGCTATATCGTCACCACCCGCGGTTTAACTAAG
ATGCTGGACAAGTACAAAAAAGCAGAATTCGGCAAATGCCCACGCGTAAACTGTCATTCCCACCCCCTCTTACCA
ATGGGTCTATCCGACGTCCCCAACGCCAAAGCCGTGAAACTCTACTGCGCCCGCTGCGAAGACATCTACAACCCC
AAATCATCACGTCACGCCGCCATCGACGGCGCCTACTTCGGCACCTCGTTCCACAACATCATCTTCCAGGTCTAT
CCCGCCCTCGTGCCTTCCAAGCTGGTGGACCGCTACGTGCCCCGCGTCTACGGCTTCAAGGTCCATGCCTCGGCT
GCGCTCGTCAGGTGGCAGAATGCGAGGAGGGATGCTATGCGGCGGCGGTTGCGGCGGTTGGAGATTGACTCGGGG
TTTAAGGAGGAGATGCCGGTTGAGGATCAGGATGTGCAGGATGTTGAGATTGAAGGCGCTTTTGATTGA
Transcript >Ophcf2|04388
ATGGACGACTACGTTAGCGAATCCGATAGCGACTATACCAGTTACTGGCGTGACTGGTTTATATCATCCCGAGGA
AACGAGTATTTCTGCGAAATCGACGAGGATTATCTCACTGATCGATTTAACCTAACGGGTCTCATTACAGAAGTG
CAATACTATCAATATGCACTTGACCTTGTCACCGATGTCTTTGACCTCGATTGCGATGATGAGATGCGCGAGACG
ATTGAGAAATCTGCTCGTCATCTATACGGTCTCGTTCACGCCCGCTATATCGTCACCACCCGCGGTTTAACTAAG
ATGCTGGACAAGTACAAAAAAGCAGAATTCGGCAAATGCCCACGCGTAAACTGTCATTCCCACCCCCTCTTACCA
ATGGGTCTATCCGACGTCCCCAACGCCAAAGCCGTGAAACTCTACTGCGCCCGCTGCGAAGACATCTACAACCCC
AAATCATCACGTCACGCCGCCATCGACGGCGCCTACTTCGGCACCTCGTTCCACAACATCATCTTCCAGGTCTAT
CCCGCCCTCGTGCCTTCCAAGCTGGTGGACCGCTACGTGCCCCGCGTCTACGGCTTCAAGGTCCATGCCTCGGCT
GCGCTCGTCAGGTGGCAGAATGCGAGGAGGGATGCTATGCGGCGGCGGTTGCGGCGGTTGGAGATTGACTCGGGG
TTTAAGGAGGAGATGCCGGTTGAGGATCAGGATGTGCAGGATGTTGAGATTGAAGGCGCTTTTGATTGA
Gene >Ophcf2|04388
ATGGACGACTACGTTAGCGAATCCGATAGCGACTATACCAGTTACTGGCGTGACTGGGTGAGAAGGAATTCTTTT
TTTTTTTTTATCTTTCTTTTTGTTTGACGTTGTTCTGCTTCGCTGCTTGGTGATGGGGGGCGCCGTTGACGATTA
CTTTCTCGTTTTTGAAGAAGGAGATTGCTGACATTTTTTTGCGGTAGTTTATATCATCCCGAGGAAACGAGTATT
TCTGCGAAATCGACGAGGATTATCTCACTGATCGATTTAACCTAACGGGTCTCATTACAGAAGTGCAATACTATC
AATATGCACTTGACCTTGTCACCGATGTCTTTGACCTCGATTGCGATGATGAGATGCGCGAGACGATTGAGAAAT
CTGCTCGTCATCTATACGGTCTCGTTCACGCCCGCTATATCGTCACCACCCGCGGTTTAACTAAGATGGTTCGTC
GTTGTCTTTATTCCCCCCCCTCTGGAAGCAAGAGGAAGCAAAATCGAAAAACTAACCTCGTCTCTTCGCTGTCAG
CTGGACAAGTACAAAAAAGCAGAATTCGGCAAATGCCCACGCGTAAACTGTCATTCCCACCCCCTCTTACCAATG
GGTCTATCCGACGTCCCCAACGCCAAAGCCGTGAAACTCTACTGCGCCCGCTGCGAAGACATCTACAACCCCAAA
TCATCACGTCACGCCGCCATCGACGGCGCCTACTTCGGCACCTCGTTCCACAACATCATCTTCCAGGTCTATCCC
GCCCTCGTGCCTTCCAAGCTGGTGGACCGCTACGTGCCCCGCGTCTACGGCTTCAAGGTCCATGCCTCGGCTGCG
CTCGTCAGGTGGCAGAATGCGAGGAGGGATGCTATGCGGCGGCGGTTGCGGCGGTTGGAGATTGACTCGGGGTTT
AAGGAGGAGATGCCGGTTGAGGATCAGGATGTGCAGGATGTTGAGATTGAAGGCGCTTTTGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail