Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04387
Gene name
Locationscaffold_04:3111257..3112675
Strand+
Gene length (bp)1418
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 3.4E-24 116 340

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 68 90 22
3 110 132 22
4 284 306 22
5 316 338 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04387
MAQPGSSSTSQLSSLRLAASYAFDWIILIVVVVIAGFLGRIEPQKRPFSLDDPNISFPFTEHQAVPTWLLVVLSA
LLPAVIILIVSVLLVPGATVPKKTPQSLIWKRKLWEIHVGWLGLLLSVGSAFFFISGIKNMCGKPRPDLLSRCEP
DLARRDMYRVGGFAGEAAGALLYSGNICQQKDKYKLDDGFRSYPSGHSATAAAGLIYLSLYLASKFAVTIPFVVP
NPNKRDEASSLAAFPSRVNDGAVNYGADYYGYSASGKPENVAHRSAQHNVRIQSLRRQAAAPPIYLLVVTLVPFC
LAIFIAASRWFDFRHHGFDILFGFLIGTITAIYSFRYYHMPIKAGAGWAWGARSPDRAFWAGVGRLGYVGDRSDF
DARVDRADLGESADVDMQPAPASNASTAGGVNYRPAHYATGAPHFQDVELDRMERHHHIVGQPPPQQQAMGPSAM
RGY*
Coding >Ophcf2|04387
ATGGCCCAACCAGGGTCGTCGTCGACGAGTCAGCTCTCGTCTCTACGCCTCGCCGCCTCGTATGCCTTTGACTGG
ATAATTCTTATCGTCGTCGTCGTCATCGCTGGTTTTCTCGGCCGAATTGAGCCCCAGAAGCGACCCTTTTCCCTC
GATGACCCCAATATCTCTTTCCCCTTCACGGAGCATCAGGCGGTGCCTACGTGGCTGCTCGTCGTCCTGTCCGCT
CTCCTGCCTGCCGTCATCATCCTCATCGTCTCGGTCCTCCTGGTCCCCGGCGCCACGGTACCGAAGAAGACGCCT
CAGTCATTGATCTGGAAGCGCAAGCTATGGGAGATTCACGTAGGCTGGCTCGGCCTCTTGCTCTCCGTCGGCTCG
GCCTTCTTCTTCATCAGCGGCATCAAGAATATGTGCGGCAAGCCGCGGCCGGATCTGCTGTCGCGCTGTGAACCC
GATCTCGCCCGTCGCGACATGTATCGCGTCGGCGGCTTTGCGGGAGAGGCTGCCGGCGCCCTCCTCTATTCGGGC
AACATCTGCCAGCAAAAGGACAAGTACAAGCTCGACGACGGCTTCCGCAGCTATCCCAGCGGCCACTCGGCCACA
GCCGCTGCCGGACTCATCTACCTTTCGCTGTATCTGGCCAGCAAGTTCGCCGTCACGATACCGTTCGTCGTTCCC
AACCCCAACAAGCGCGACGAGGCATCTTCGCTCGCGGCCTTTCCCTCTCGCGTCAACGACGGGGCGGTCAACTAC
GGCGCCGACTACTACGGCTACTCAGCCTCTGGCAAGCCCGAAAACGTGGCTCACCGCAGCGCCCAGCACAACGTC
AGAATACAGTCGCTGCGTCGACAGGCGGCTGCGCCACCCATCTACCTCCTCGTCGTCACCCTGGTGCCCTTTTGC
CTGGCCATCTTCATCGCAGCCTCGCGCTGGTTCGACTTCCGTCATCACGGCTTCGACATCCTTTTCGGCTTCCTC
ATCGGCACCATCACGGCCATCTACAGCTTCCGCTACTACCACATGCCTATCAAGGCCGGTGCCGGCTGGGCTTGG
GGCGCCCGCAGCCCCGACCGCGCCTTTTGGGCTGGCGTCGGCCGTCTCGGCTACGTCGGCGACCGGTCCGACTTT
GATGCCCGCGTCGACCGCGCCGACCTCGGCGAGTCGGCCGACGTGGATATGCAGCCGGCGCCGGCTTCGAACGCG
TCGACGGCGGGCGGCGTGAATTATCGCCCTGCGCACTACGCGACCGGCGCGCCGCACTTCCAGGACGTCGAACTC
GACCGTATGGAGCGTCATCATCATATCGTGGGCCAGCCGCCGCCGCAGCAACAAGCCATGGGCCCTTCCGCCATG
AGGGGCTACTAG
Transcript >Ophcf2|04387
ATGGCCCAACCAGGGTCGTCGTCGACGAGTCAGCTCTCGTCTCTACGCCTCGCCGCCTCGTATGCCTTTGACTGG
ATAATTCTTATCGTCGTCGTCGTCATCGCTGGTTTTCTCGGCCGAATTGAGCCCCAGAAGCGACCCTTTTCCCTC
GATGACCCCAATATCTCTTTCCCCTTCACGGAGCATCAGGCGGTGCCTACGTGGCTGCTCGTCGTCCTGTCCGCT
CTCCTGCCTGCCGTCATCATCCTCATCGTCTCGGTCCTCCTGGTCCCCGGCGCCACGGTACCGAAGAAGACGCCT
CAGTCATTGATCTGGAAGCGCAAGCTATGGGAGATTCACGTAGGCTGGCTCGGCCTCTTGCTCTCCGTCGGCTCG
GCCTTCTTCTTCATCAGCGGCATCAAGAATATGTGCGGCAAGCCGCGGCCGGATCTGCTGTCGCGCTGTGAACCC
GATCTCGCCCGTCGCGACATGTATCGCGTCGGCGGCTTTGCGGGAGAGGCTGCCGGCGCCCTCCTCTATTCGGGC
AACATCTGCCAGCAAAAGGACAAGTACAAGCTCGACGACGGCTTCCGCAGCTATCCCAGCGGCCACTCGGCCACA
GCCGCTGCCGGACTCATCTACCTTTCGCTGTATCTGGCCAGCAAGTTCGCCGTCACGATACCGTTCGTCGTTCCC
AACCCCAACAAGCGCGACGAGGCATCTTCGCTCGCGGCCTTTCCCTCTCGCGTCAACGACGGGGCGGTCAACTAC
GGCGCCGACTACTACGGCTACTCAGCCTCTGGCAAGCCCGAAAACGTGGCTCACCGCAGCGCCCAGCACAACGTC
AGAATACAGTCGCTGCGTCGACAGGCGGCTGCGCCACCCATCTACCTCCTCGTCGTCACCCTGGTGCCCTTTTGC
CTGGCCATCTTCATCGCAGCCTCGCGCTGGTTCGACTTCCGTCATCACGGCTTCGACATCCTTTTCGGCTTCCTC
ATCGGCACCATCACGGCCATCTACAGCTTCCGCTACTACCACATGCCTATCAAGGCCGGTGCCGGCTGGGCTTGG
GGCGCCCGCAGCCCCGACCGCGCCTTTTGGGCTGGCGTCGGCCGTCTCGGCTACGTCGGCGACCGGTCCGACTTT
GATGCCCGCGTCGACCGCGCCGACCTCGGCGAGTCGGCCGACGTGGATATGCAGCCGGCGCCGGCTTCGAACGCG
TCGACGGCGGGCGGCGTGAATTATCGCCCTGCGCACTACGCGACCGGCGCGCCGCACTTCCAGGACGTCGAACTC
GACCGTATGGAGCGTCATCATCATATCGTGGGCCAGCCGCCGCCGCAGCAACAAGCCATGGGCCCTTCCGCCATG
AGGGGCTACTAG
Gene >Ophcf2|04387
ATGGCCCAACCAGGGTCGTCGTCGACGAGTCAGCTCTCGTCTCTACGCCTCGCCGCCTCGTATGCCTTTGACTGG
ATAATTCTTATCGTCGTCGTCGTCATCGCTGGTTTTCTCGGCCGAATTGAGCCCCAGAAGCGACCCTTTTCCCTC
GATGACCCCAATATCTCGTCAGTGGCACGATACACGCCCGTCGCGCATAACATCGCTGACACGTGAAATCTAGTT
TCCCCTTCACGGAGCATCAGGCGGTGCCTACGTGGCTGCTCGTCGTCCTGTCCGCTCTCCTGCCTGCCGTCATCA
TCCTCATCGTCTCGGTCCTCCTGGTCCCCGGCGCCACGGTACCGAAGAAGACGCCTCAGTCATTGATCTGGAAGC
GCAAGCTATGGGAGATTCACGTAGGCTGGCTCGGCCTCTTGCTCTCCGTCGGCTCGGCCTTCTTCTTCATCAGCG
GCATCAAGAATATGTGCGGCAAGCCGCGGCCGGATCTGCTGTCGCGCTGTGAACCCGATCTCGCCCGTCGCGACA
TGTATCGCGTCGGCGGCTTTGCGGGAGAGGCTGCCGGCGCCCTCCTCTATTCGGGCAACATCTGCCAGCAAAAGG
ACAAGTACAAGCTCGACGACGGCTTCCGCAGCTATCCCAGCGGCCACTCGGCCACAGCCGCTGCCGGACTCATCT
ACCTTTCGCTGTATCTGGCCAGCAAGTTCGCCGTCACGATACCGTTCGTCGTTCCCAACCCCAACAAGCGCGACG
AGGCATCTTCGCTCGCGGCCTTTCCCTCTCGCGTCAACGACGGGGCGGTCAACTACGGCGCCGACTACTACGGCT
ACTCAGCCTCTGGCAAGCCCGAAAACGTGGCTCACCGCAGCGCCCAGCACAACGTCAGAATACAGTCGCTGCGTC
GACAGGCGGCTGCGCCACCCATCTACCTCCTCGTCGTCACCCTGGTGCCCTTTTGCCTGGCCATCTTCATCGCAG
CCTCGCGCTGGTTCGACTTCCGTCATCACGGCTTCGACATCCTTTTCGGCTTCCTCATCGGCACCATCACGGCCA
TCTACAGCTTCCGCTACTACCACATGCCTATCAAGGCCGGTGCCGGCTGGGCTTGGGGCGCCCGCAGCCCCGACC
GCGCCTTTTGGGCTGGCGTCGGCCGTCTCGGCTACGTCGGCGACCGGTCCGACTTTGATGCCCGCGTCGACCGCG
CCGACCTCGGCGAGTCGGCCGACGTGGATATGCAGCCGGCGCCGGCTTCGAACGCGTCGACGGCGGGCGGCGTGA
ATTATCGCCCTGCGCACTACGCGACCGGCGCGCCGCACTTCCAGGACGTCGAACTCGACCGTATGGAGCGTCATC
ATCATATCGTGGGCCAGCCGCCGCCGCAGCAACAAGCCATGGGCCCTTCCGCCATGAGGGGCTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail