Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04376
Gene name
Locationscaffold_04:3075182..3078806
Strand-
Gene length (bp)3624
Transcript length (bp)3624
Coding sequence length (bp)3624
Protein length (aa) 1208

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08920 SF3b1 Splicing factor 3B subunit 1 5.9E-17 237 351

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.54 0.5522 0.0481 0.0376 0.0715 0.0076 0.0671 0.1254 0.156 0.0203

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3737
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4821
Ophiocordyceps australis map64 (Brazil) OphauB2|3934
Ophiocordyceps camponoti-floridani Ophcf2|04376 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3076
Ophiocordyceps kimflemingae Ophio5|3897
Ophiocordyceps subramaniannii Hirsu2|7292

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04376
MSDADFEAVARLQRERNAAAAGKKNSHDASNQRGDSKRQKLTENADNDLYEKVGDDKFAGYHQSLPMGDDEDDAG
EDRTVRLTGQYTASRDLIDEFARGEGVEEDDVLAGRGEKSGRIIDRESDYQKRRFNRVLTPTRADPFAENRRAGA
TEAGTTYREIMQSNELDREEERVRRAIQAKQKDEANVEHAKPTLQNTEKENSEAGSTELVTAGRKRKKRWDISST
PADDQSQSEAAPPKRSRWDEAPSVSSEPQRQRSRWDQAPSATPMGSSGLSTPAQPTKALSLPTTFGTDIGRNLSL
TDEELDMLLPGEDQGYKILEFPAGFVQARVPSHRSMAMPPPPTGFIMQDPDQVRLGGQPMPTEISGVGDLQFLKP
EDMTYFGKLNDGVDESTMSVDELKERKIMKLLLKIKNGTPPMRKTALRQITDNARQFGPGPLFAQILPLLMEKTL
EEQERHLLVKVIDRILYKLDDLVRPFVHKILVVIEPLLIDQDYYARVEGREIISNVAKAAGLATMISVMRPDIDH
VDDYVRNTTARAFAVVASALSIPALLPFLSAVCRSKKSWHARHTGVKIVQQIAILMGCAVLPHLKGLVECIANNL
NDDQTKVRTVTSLAIAALAEASNPYGIESFDEILNPLWTGARKQRGKGLAGFLKAVGYIIPLMDEEYANYYTTQI
MEILLREFASPDEEMKKVVLKVVSQCAATKGVSGNYLKEHVLDDFFKNFWVKRMALDKRNYKQVVETTVDIGQKV
GVSEMLERIVDNLKDESEAYRKMTVETMEKVVTSLGAADIDDRLEERLVDGILYTFQEQSVEDIVILNGFGSVVN
ALGERCGPFLPQITSTILWRLNHKSPTVRQQAADLISRIAMVMKQCGEDELMGKLGVVLYEYLGEEYPEVLGSML
GALRSIVTVVGIAQMQPPIKDLLPRLTPILRNRHEKVQENTIDLVGRIADRGPESVNAREWMRICFELLDMLKAH
KKGIRRAANNTFGFIAKAIGPQDVLATLLSNLRVQERQSRVNTAVAIGIVAETCAPFTVLPALMNEYRVPELNVQ
NGVLKALSFLFEYIGEMGKDYVYAVTPLLEDALIDRDQVHRQTAASVVKHIGLGVIGLGCEDAMVHLLNLLYPNL
FETSPHVIDRIIEAIEAIRMAVGPGAVLNYVWAGLFHPARKVRTPYWRLFNDAYVQGADAMVPYYPNWCEDGLDR
PELGTML*
Coding >Ophcf2|04376
ATGTCGGACGCCGACTTTGAGGCGGTGGCCAGGCTGCAGCGGGAGCGCAACGCTGCGGCGGCAGGAAAGAAAAAC
TCGCACGACGCCTCGAACCAACGCGGCGATTCGAAACGCCAGAAGCTCACTGAAAATGCCGACAACGATCTGTAT
GAAAAGGTTGGCGATGACAAGTTTGCGGGTTATCATCAGTCTCTCCCGATGGGCGATGACGAGGACGACGCTGGC
GAGGACCGCACTGTCCGTCTAACTGGCCAGTACACGGCCTCTCGAGACTTGATCGACGAGTTTGCCCGAGGCGAA
GGAGTGGAGGAAGACGACGTTCTGGCTGGACGGGGAGAGAAGAGCGGCCGGATCATCGATCGCGAGAGCGACTAC
CAGAAGCGTCGGTTCAACCGCGTCCTGACGCCCACCAGAGCCGATCCCTTTGCCGAGAATCGCCGGGCTGGGGCG
ACGGAAGCGGGAACGACGTATCGCGAGATCATGCAGAGCAATGAACTCGACAGAGAGGAGGAGCGCGTTCGACGA
GCCATTCAAGCCAAGCAGAAGGATGAGGCAAATGTCGAGCACGCCAAGCCCACGCTCCAAAACACGGAAAAGGAG
AATTCCGAGGCCGGTTCGACGGAGCTGGTGACGGCGGGTCGCAAGCGAAAGAAGAGATGGGACATTTCGTCTACG
CCGGCCGATGACCAGTCACAGTCCGAGGCTGCGCCGCCGAAGCGCTCCAGATGGGACGAAGCACCGTCCGTGTCG
TCGGAGCCACAGAGACAGCGTTCCCGCTGGGATCAGGCCCCGTCGGCGACGCCCATGGGCAGCTCGGGACTCTCG
ACCCCCGCGCAGCCGACAAAGGCTCTCTCGTTGCCGACCACGTTCGGCACCGATATTGGACGAAACCTGTCGCTG
ACGGACGAGGAGCTCGACATGCTGCTGCCCGGCGAGGACCAGGGCTACAAGATTCTCGAATTTCCTGCCGGCTTC
GTTCAGGCCCGCGTCCCGTCGCATAGGTCAATGGCGATGCCCCCTCCGCCGACGGGCTTCATCATGCAGGACCCC
GATCAAGTGCGGCTGGGTGGCCAACCCATGCCGACGGAGATCTCGGGAGTCGGAGACTTGCAGTTCCTCAAGCCC
GAGGACATGACGTATTTCGGAAAGCTCAACGACGGCGTCGACGAGAGCACCATGTCGGTCGACGAGCTCAAGGAG
AGGAAGATCATGAAGCTACTGCTCAAGATCAAGAACGGAACGCCACCCATGCGCAAGACTGCTCTTCGGCAAATC
ACGGACAACGCGAGGCAGTTTGGACCGGGCCCCTTGTTCGCGCAGATCCTCCCGCTGCTGATGGAGAAGACGCTG
GAGGAGCAGGAACGCCATCTCCTGGTCAAGGTCATCGACCGCATTCTGTACAAGCTGGACGACCTCGTGCGGCCG
TTTGTGCACAAGATCCTAGTGGTCATCGAGCCGCTCCTCATCGACCAGGACTACTATGCACGAGTCGAGGGCCGA
GAGATCATCTCCAACGTGGCCAAGGCTGCCGGGCTCGCGACCATGATCAGCGTGATGCGACCCGACATCGACCAC
GTCGACGACTACGTGCGAAACACTACAGCCAGAGCGTTTGCGGTGGTGGCTTCGGCCCTCTCGATCCCTGCCCTG
CTCCCGTTCCTGAGCGCCGTTTGCCGCAGCAAAAAGTCGTGGCACGCGCGTCACACCGGGGTCAAGATCGTGCAG
CAGATTGCCATTCTGATGGGATGCGCGGTGCTGCCACACCTCAAGGGCCTGGTGGAGTGCATCGCCAACAACCTC
AACGACGACCAGACCAAGGTGCGGACGGTGACCAGTCTCGCTATCGCCGCATTGGCTGAGGCGTCCAACCCTTAT
GGCATCGAGAGCTTCGACGAGATCCTCAACCCGCTGTGGACGGGAGCGCGCAAGCAGAGAGGCAAGGGCCTCGCC
GGGTTCCTCAAGGCTGTGGGATACATCATCCCGCTGATGGACGAGGAGTACGCCAACTACTACACGACTCAGATC
ATGGAGATTTTGCTGCGCGAGTTCGCGTCGCCGGACGAGGAGATGAAGAAGGTGGTGCTCAAGGTGGTGTCGCAG
TGCGCGGCAACAAAGGGCGTGAGCGGCAACTATCTCAAGGAACACGTGCTGGACGACTTCTTCAAGAACTTTTGG
GTCAAGCGGATGGCGCTGGACAAGCGCAACTACAAGCAGGTGGTGGAGACGACGGTGGACATCGGACAGAAGGTG
GGCGTGAGCGAGATGCTGGAGCGAATCGTGGACAACCTCAAGGACGAGAGCGAGGCGTACCGCAAGATGACGGTG
GAGACGATGGAGAAGGTGGTGACGAGCCTCGGAGCGGCCGACATCGACGACCGGCTGGAGGAGCGACTGGTGGAC
GGGATCCTTTACACGTTCCAGGAGCAGAGCGTCGAGGACATTGTCATCCTCAACGGGTTCGGATCGGTGGTGAAC
GCGCTGGGCGAGCGGTGCGGACCCTTCTTGCCGCAGATCACGAGCACCATCCTCTGGCGGCTCAACCACAAGTCG
CCGACGGTACGACAGCAGGCGGCGGACCTCATCTCGCGGATCGCCATGGTGATGAAGCAGTGCGGCGAGGACGAG
CTGATGGGCAAGCTGGGAGTGGTGCTGTACGAATACCTGGGCGAGGAGTATCCCGAGGTGCTGGGATCGATGCTG
GGAGCGCTACGGTCCATCGTGACGGTGGTGGGCATCGCACAGATGCAGCCTCCCATCAAGGACCTGCTGCCGCGG
CTGACGCCCATCCTCCGCAACCGGCACGAAAAGGTGCAGGAGAACACGATCGACCTGGTGGGAAGGATCGCGGAC
CGGGGCCCGGAGAGCGTCAACGCGCGCGAGTGGATGCGCATCTGCTTCGAGCTGCTCGACATGCTCAAGGCTCAC
AAGAAGGGGATCCGACGAGCGGCCAACAACACGTTTGGCTTCATCGCAAAGGCCATCGGGCCGCAGGACGTGCTG
GCGACGCTGCTGAGCAACTTGCGGGTGCAGGAGCGCCAGTCCCGGGTCAACACGGCGGTGGCGATTGGCATCGTG
GCCGAGACGTGCGCGCCCTTTACCGTGCTGCCGGCCCTGATGAACGAGTACCGGGTGCCGGAGCTCAACGTGCAG
AACGGGGTGCTCAAGGCGCTGTCGTTCCTGTTCGAATACATTGGCGAGATGGGCAAGGACTACGTGTACGCCGTG
ACGCCGCTGCTGGAGGACGCGCTCATCGACCGGGATCAGGTGCACCGGCAGACGGCGGCTTCGGTAGTCAAGCAC
ATCGGGCTGGGCGTCATCGGGCTGGGGTGCGAGGACGCCATGGTTCACCTGCTGAACCTGCTGTACCCGAACCTG
TTTGAGACGAGCCCGCACGTCATCGACCGCATCATCGAGGCCATCGAGGCCATCCGGATGGCCGTGGGGCCGGGC
GCCGTCCTCAACTACGTCTGGGCCGGCCTGTTCCATCCGGCTCGAAAGGTGCGGACGCCGTACTGGCGCTTGTTC
AACGACGCGTACGTGCAGGGGGCCGATGCCATGGTACCTTATTATCCGAACTGGTGCGAGGACGGGCTGGACAGG
CCGGAGCTGGGAACGATGCTGTAG
Transcript >Ophcf2|04376
ATGTCGGACGCCGACTTTGAGGCGGTGGCCAGGCTGCAGCGGGAGCGCAACGCTGCGGCGGCAGGAAAGAAAAAC
TCGCACGACGCCTCGAACCAACGCGGCGATTCGAAACGCCAGAAGCTCACTGAAAATGCCGACAACGATCTGTAT
GAAAAGGTTGGCGATGACAAGTTTGCGGGTTATCATCAGTCTCTCCCGATGGGCGATGACGAGGACGACGCTGGC
GAGGACCGCACTGTCCGTCTAACTGGCCAGTACACGGCCTCTCGAGACTTGATCGACGAGTTTGCCCGAGGCGAA
GGAGTGGAGGAAGACGACGTTCTGGCTGGACGGGGAGAGAAGAGCGGCCGGATCATCGATCGCGAGAGCGACTAC
CAGAAGCGTCGGTTCAACCGCGTCCTGACGCCCACCAGAGCCGATCCCTTTGCCGAGAATCGCCGGGCTGGGGCG
ACGGAAGCGGGAACGACGTATCGCGAGATCATGCAGAGCAATGAACTCGACAGAGAGGAGGAGCGCGTTCGACGA
GCCATTCAAGCCAAGCAGAAGGATGAGGCAAATGTCGAGCACGCCAAGCCCACGCTCCAAAACACGGAAAAGGAG
AATTCCGAGGCCGGTTCGACGGAGCTGGTGACGGCGGGTCGCAAGCGAAAGAAGAGATGGGACATTTCGTCTACG
CCGGCCGATGACCAGTCACAGTCCGAGGCTGCGCCGCCGAAGCGCTCCAGATGGGACGAAGCACCGTCCGTGTCG
TCGGAGCCACAGAGACAGCGTTCCCGCTGGGATCAGGCCCCGTCGGCGACGCCCATGGGCAGCTCGGGACTCTCG
ACCCCCGCGCAGCCGACAAAGGCTCTCTCGTTGCCGACCACGTTCGGCACCGATATTGGACGAAACCTGTCGCTG
ACGGACGAGGAGCTCGACATGCTGCTGCCCGGCGAGGACCAGGGCTACAAGATTCTCGAATTTCCTGCCGGCTTC
GTTCAGGCCCGCGTCCCGTCGCATAGGTCAATGGCGATGCCCCCTCCGCCGACGGGCTTCATCATGCAGGACCCC
GATCAAGTGCGGCTGGGTGGCCAACCCATGCCGACGGAGATCTCGGGAGTCGGAGACTTGCAGTTCCTCAAGCCC
GAGGACATGACGTATTTCGGAAAGCTCAACGACGGCGTCGACGAGAGCACCATGTCGGTCGACGAGCTCAAGGAG
AGGAAGATCATGAAGCTACTGCTCAAGATCAAGAACGGAACGCCACCCATGCGCAAGACTGCTCTTCGGCAAATC
ACGGACAACGCGAGGCAGTTTGGACCGGGCCCCTTGTTCGCGCAGATCCTCCCGCTGCTGATGGAGAAGACGCTG
GAGGAGCAGGAACGCCATCTCCTGGTCAAGGTCATCGACCGCATTCTGTACAAGCTGGACGACCTCGTGCGGCCG
TTTGTGCACAAGATCCTAGTGGTCATCGAGCCGCTCCTCATCGACCAGGACTACTATGCACGAGTCGAGGGCCGA
GAGATCATCTCCAACGTGGCCAAGGCTGCCGGGCTCGCGACCATGATCAGCGTGATGCGACCCGACATCGACCAC
GTCGACGACTACGTGCGAAACACTACAGCCAGAGCGTTTGCGGTGGTGGCTTCGGCCCTCTCGATCCCTGCCCTG
CTCCCGTTCCTGAGCGCCGTTTGCCGCAGCAAAAAGTCGTGGCACGCGCGTCACACCGGGGTCAAGATCGTGCAG
CAGATTGCCATTCTGATGGGATGCGCGGTGCTGCCACACCTCAAGGGCCTGGTGGAGTGCATCGCCAACAACCTC
AACGACGACCAGACCAAGGTGCGGACGGTGACCAGTCTCGCTATCGCCGCATTGGCTGAGGCGTCCAACCCTTAT
GGCATCGAGAGCTTCGACGAGATCCTCAACCCGCTGTGGACGGGAGCGCGCAAGCAGAGAGGCAAGGGCCTCGCC
GGGTTCCTCAAGGCTGTGGGATACATCATCCCGCTGATGGACGAGGAGTACGCCAACTACTACACGACTCAGATC
ATGGAGATTTTGCTGCGCGAGTTCGCGTCGCCGGACGAGGAGATGAAGAAGGTGGTGCTCAAGGTGGTGTCGCAG
TGCGCGGCAACAAAGGGCGTGAGCGGCAACTATCTCAAGGAACACGTGCTGGACGACTTCTTCAAGAACTTTTGG
GTCAAGCGGATGGCGCTGGACAAGCGCAACTACAAGCAGGTGGTGGAGACGACGGTGGACATCGGACAGAAGGTG
GGCGTGAGCGAGATGCTGGAGCGAATCGTGGACAACCTCAAGGACGAGAGCGAGGCGTACCGCAAGATGACGGTG
GAGACGATGGAGAAGGTGGTGACGAGCCTCGGAGCGGCCGACATCGACGACCGGCTGGAGGAGCGACTGGTGGAC
GGGATCCTTTACACGTTCCAGGAGCAGAGCGTCGAGGACATTGTCATCCTCAACGGGTTCGGATCGGTGGTGAAC
GCGCTGGGCGAGCGGTGCGGACCCTTCTTGCCGCAGATCACGAGCACCATCCTCTGGCGGCTCAACCACAAGTCG
CCGACGGTACGACAGCAGGCGGCGGACCTCATCTCGCGGATCGCCATGGTGATGAAGCAGTGCGGCGAGGACGAG
CTGATGGGCAAGCTGGGAGTGGTGCTGTACGAATACCTGGGCGAGGAGTATCCCGAGGTGCTGGGATCGATGCTG
GGAGCGCTACGGTCCATCGTGACGGTGGTGGGCATCGCACAGATGCAGCCTCCCATCAAGGACCTGCTGCCGCGG
CTGACGCCCATCCTCCGCAACCGGCACGAAAAGGTGCAGGAGAACACGATCGACCTGGTGGGAAGGATCGCGGAC
CGGGGCCCGGAGAGCGTCAACGCGCGCGAGTGGATGCGCATCTGCTTCGAGCTGCTCGACATGCTCAAGGCTCAC
AAGAAGGGGATCCGACGAGCGGCCAACAACACGTTTGGCTTCATCGCAAAGGCCATCGGGCCGCAGGACGTGCTG
GCGACGCTGCTGAGCAACTTGCGGGTGCAGGAGCGCCAGTCCCGGGTCAACACGGCGGTGGCGATTGGCATCGTG
GCCGAGACGTGCGCGCCCTTTACCGTGCTGCCGGCCCTGATGAACGAGTACCGGGTGCCGGAGCTCAACGTGCAG
AACGGGGTGCTCAAGGCGCTGTCGTTCCTGTTCGAATACATTGGCGAGATGGGCAAGGACTACGTGTACGCCGTG
ACGCCGCTGCTGGAGGACGCGCTCATCGACCGGGATCAGGTGCACCGGCAGACGGCGGCTTCGGTAGTCAAGCAC
ATCGGGCTGGGCGTCATCGGGCTGGGGTGCGAGGACGCCATGGTTCACCTGCTGAACCTGCTGTACCCGAACCTG
TTTGAGACGAGCCCGCACGTCATCGACCGCATCATCGAGGCCATCGAGGCCATCCGGATGGCCGTGGGGCCGGGC
GCCGTCCTCAACTACGTCTGGGCCGGCCTGTTCCATCCGGCTCGAAAGGTGCGGACGCCGTACTGGCGCTTGTTC
AACGACGCGTACGTGCAGGGGGCCGATGCCATGGTACCTTATTATCCGAACTGGTGCGAGGACGGGCTGGACAGG
CCGGAGCTGGGAACGATGCTGTAG
Gene >Ophcf2|04376
ATGTCGGACGCCGACTTTGAGGCGGTGGCCAGGCTGCAGCGGGAGCGCAACGCTGCGGCGGCAGGAAAGAAAAAC
TCGCACGACGCCTCGAACCAACGCGGCGATTCGAAACGCCAGAAGCTCACTGAAAATGCCGACAACGATCTGTAT
GAAAAGGTTGGCGATGACAAGTTTGCGGGTTATCATCAGTCTCTCCCGATGGGCGATGACGAGGACGACGCTGGC
GAGGACCGCACTGTCCGTCTAACTGGCCAGTACACGGCCTCTCGAGACTTGATCGACGAGTTTGCCCGAGGCGAA
GGAGTGGAGGAAGACGACGTTCTGGCTGGACGGGGAGAGAAGAGCGGCCGGATCATCGATCGCGAGAGCGACTAC
CAGAAGCGTCGGTTCAACCGCGTCCTGACGCCCACCAGAGCCGATCCCTTTGCCGAGAATCGCCGGGCTGGGGCG
ACGGAAGCGGGAACGACGTATCGCGAGATCATGCAGAGCAATGAACTCGACAGAGAGGAGGAGCGCGTTCGACGA
GCCATTCAAGCCAAGCAGAAGGATGAGGCAAATGTCGAGCACGCCAAGCCCACGCTCCAAAACACGGAAAAGGAG
AATTCCGAGGCCGGTTCGACGGAGCTGGTGACGGCGGGTCGCAAGCGAAAGAAGAGATGGGACATTTCGTCTACG
CCGGCCGATGACCAGTCACAGTCCGAGGCTGCGCCGCCGAAGCGCTCCAGATGGGACGAAGCACCGTCCGTGTCG
TCGGAGCCACAGAGACAGCGTTCCCGCTGGGATCAGGCCCCGTCGGCGACGCCCATGGGCAGCTCGGGACTCTCG
ACCCCCGCGCAGCCGACAAAGGCTCTCTCGTTGCCGACCACGTTCGGCACCGATATTGGACGAAACCTGTCGCTG
ACGGACGAGGAGCTCGACATGCTGCTGCCCGGCGAGGACCAGGGCTACAAGATTCTCGAATTTCCTGCCGGCTTC
GTTCAGGCCCGCGTCCCGTCGCATAGGTCAATGGCGATGCCCCCTCCGCCGACGGGCTTCATCATGCAGGACCCC
GATCAAGTGCGGCTGGGTGGCCAACCCATGCCGACGGAGATCTCGGGAGTCGGAGACTTGCAGTTCCTCAAGCCC
GAGGACATGACGTATTTCGGAAAGCTCAACGACGGCGTCGACGAGAGCACCATGTCGGTCGACGAGCTCAAGGAG
AGGAAGATCATGAAGCTACTGCTCAAGATCAAGAACGGAACGCCACCCATGCGCAAGACTGCTCTTCGGCAAATC
ACGGACAACGCGAGGCAGTTTGGACCGGGCCCCTTGTTCGCGCAGATCCTCCCGCTGCTGATGGAGAAGACGCTG
GAGGAGCAGGAACGCCATCTCCTGGTCAAGGTCATCGACCGCATTCTGTACAAGCTGGACGACCTCGTGCGGCCG
TTTGTGCACAAGATCCTAGTGGTCATCGAGCCGCTCCTCATCGACCAGGACTACTATGCACGAGTCGAGGGCCGA
GAGATCATCTCCAACGTGGCCAAGGCTGCCGGGCTCGCGACCATGATCAGCGTGATGCGACCCGACATCGACCAC
GTCGACGACTACGTGCGAAACACTACAGCCAGAGCGTTTGCGGTGGTGGCTTCGGCCCTCTCGATCCCTGCCCTG
CTCCCGTTCCTGAGCGCCGTTTGCCGCAGCAAAAAGTCGTGGCACGCGCGTCACACCGGGGTCAAGATCGTGCAG
CAGATTGCCATTCTGATGGGATGCGCGGTGCTGCCACACCTCAAGGGCCTGGTGGAGTGCATCGCCAACAACCTC
AACGACGACCAGACCAAGGTGCGGACGGTGACCAGTCTCGCTATCGCCGCATTGGCTGAGGCGTCCAACCCTTAT
GGCATCGAGAGCTTCGACGAGATCCTCAACCCGCTGTGGACGGGAGCGCGCAAGCAGAGAGGCAAGGGCCTCGCC
GGGTTCCTCAAGGCTGTGGGATACATCATCCCGCTGATGGACGAGGAGTACGCCAACTACTACACGACTCAGATC
ATGGAGATTTTGCTGCGCGAGTTCGCGTCGCCGGACGAGGAGATGAAGAAGGTGGTGCTCAAGGTGGTGTCGCAG
TGCGCGGCAACAAAGGGCGTGAGCGGCAACTATCTCAAGGAACACGTGCTGGACGACTTCTTCAAGAACTTTTGG
GTCAAGCGGATGGCGCTGGACAAGCGCAACTACAAGCAGGTGGTGGAGACGACGGTGGACATCGGACAGAAGGTG
GGCGTGAGCGAGATGCTGGAGCGAATCGTGGACAACCTCAAGGACGAGAGCGAGGCGTACCGCAAGATGACGGTG
GAGACGATGGAGAAGGTGGTGACGAGCCTCGGAGCGGCCGACATCGACGACCGGCTGGAGGAGCGACTGGTGGAC
GGGATCCTTTACACGTTCCAGGAGCAGAGCGTCGAGGACATTGTCATCCTCAACGGGTTCGGATCGGTGGTGAAC
GCGCTGGGCGAGCGGTGCGGACCCTTCTTGCCGCAGATCACGAGCACCATCCTCTGGCGGCTCAACCACAAGTCG
CCGACGGTACGACAGCAGGCGGCGGACCTCATCTCGCGGATCGCCATGGTGATGAAGCAGTGCGGCGAGGACGAG
CTGATGGGCAAGCTGGGAGTGGTGCTGTACGAATACCTGGGCGAGGAGTATCCCGAGGTGCTGGGATCGATGCTG
GGAGCGCTACGGTCCATCGTGACGGTGGTGGGCATCGCACAGATGCAGCCTCCCATCAAGGACCTGCTGCCGCGG
CTGACGCCCATCCTCCGCAACCGGCACGAAAAGGTGCAGGAGAACACGATCGACCTGGTGGGAAGGATCGCGGAC
CGGGGCCCGGAGAGCGTCAACGCGCGCGAGTGGATGCGCATCTGCTTCGAGCTGCTCGACATGCTCAAGGCTCAC
AAGAAGGGGATCCGACGAGCGGCCAACAACACGTTTGGCTTCATCGCAAAGGCCATCGGGCCGCAGGACGTGCTG
GCGACGCTGCTGAGCAACTTGCGGGTGCAGGAGCGCCAGTCCCGGGTCAACACGGCGGTGGCGATTGGCATCGTG
GCCGAGACGTGCGCGCCCTTTACCGTGCTGCCGGCCCTGATGAACGAGTACCGGGTGCCGGAGCTCAACGTGCAG
AACGGGGTGCTCAAGGCGCTGTCGTTCCTGTTCGAATACATTGGCGAGATGGGCAAGGACTACGTGTACGCCGTG
ACGCCGCTGCTGGAGGACGCGCTCATCGACCGGGATCAGGTGCACCGGCAGACGGCGGCTTCGGTAGTCAAGCAC
ATCGGGCTGGGCGTCATCGGGCTGGGGTGCGAGGACGCCATGGTTCACCTGCTGAACCTGCTGTACCCGAACCTG
TTTGAGACGAGCCCGCACGTCATCGACCGCATCATCGAGGCCATCGAGGCCATCCGGATGGCCGTGGGGCCGGGC
GCCGTCCTCAACTACGTCTGGGCCGGCCTGTTCCATCCGGCTCGAAAGGTGCGGACGCCGTACTGGCGCTTGTTC
AACGACGCGTACGTGCAGGGGGCCGATGCCATGGTACCTTATTATCCGAACTGGTGCGAGGACGGGCTGGACAGG
CCGGAGCTGGGAACGATGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail