Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04361
Gene name
Locationscaffold_04:3033488..3035131
Strand-
Gene length (bp)1643
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 1.1E-29 26 127
PF00085 Thioredoxin Thioredoxin 1.7E-27 362 467
PF13848 Thioredoxin_6 Thioredoxin-like domain 3.2E-35 162 339

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.183 0.1212 0.6333 0.0999 0.1338 0.0028 0.6617 0.2467 0.2765 0.0106

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999366

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4109
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1928
Ophiocordyceps australis map64 (Brazil) OphauB2|3025
Ophiocordyceps camponoti-floridani Ophcf2|04361 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3041
Ophiocordyceps kimflemingae Ophio5|3155
Ophiocordyceps subramaniannii Hirsu2|8317

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04361
MHQKRLALSLASALAGVAYAADSSDVHQLTGKDFKDFIHGHKDTLVLTKFYAPWCGHCKALAPEFEAAAKTLKPR
SIKLAKIDCTEEADLCKQYEVEGYPTLKIFQGIDNVSPYNGQRKADSIHSYMVKRSLPAVSTLAKDTLEDFKTAD
KVVVIAYLAADDKESNASFSAVADSMRDEYMFGGVNDEALAEAEGVKFPSLVLYKSFDEGKNDFKGKFETDAIKD
FIKTSATPLVGEVGPETYAAYMSAGLPLGYIFAETQEQRDTLAKDLKPVAEKYKGKLNLATIDAKQFGAHAGNLN
LKTDKFPCFAIQDTTNNKKYPFDQDKELGHDNIAKFVADFVAGKIEPSIKSEPIPEKQEGPVTVVVAKNYEKIVN
DEDKDVLLEFYAPWCGHCKALAPKYEQLASAYADSDFKDKVVIAKVDATANDVPDDVAGFPTIKLYPAGAKGEPI
TYSGSRTVEDLVTFIKENGKFKAGVSIKAEGTDEAAPAATEKDAKKDKEADEVKEEHDEL*
Coding >Ophcf2|04361
ATGCATCAGAAACGCCTTGCTCTAAGCCTCGCGTCTGCCCTTGCGGGCGTCGCCTATGCCGCCGACTCTTCCGAC
GTCCACCAGCTGACGGGCAAGGACTTTAAAGACTTTATCCATGGCCACAAGGACACTCTGGTGCTGACAAAGTTC
TATGCTCCCTGGTGTGGCCACTGCAAGGCCCTGGCCCCGGAGTTTGAGGCGGCCGCAAAGACGCTCAAGCCCAGG
TCCATCAAGCTGGCCAAGATCGATTGCACAGAGGAGGCCGATCTTTGCAAGCAGTATGAAGTCGAGGGCTATCCT
ACTCTCAAAATCTTCCAGGGCATCGACAATGTCTCGCCCTACAACGGCCAGCGGAAGGCTGATAGCATTCACTCT
TACATGGTGAAGCGCTCGTTGCCCGCCGTTTCCACACTTGCCAAGGATACCCTCGAGGACTTCAAGACGGCTGAC
AAGGTCGTCGTCATTGCCTACCTGGCCGCCGACGACAAGGAGTCCAACGCTTCTTTCTCCGCCGTCGCCGATTCC
ATGCGTGATGAGTACATGTTTGGTGGCGTCAACGACGAGGCTCTTGCCGAGGCTGAGGGCGTCAAGTTCCCTTCT
CTCGTCCTGTACAAGTCATTTGACGAGGGTAAGAACGACTTCAAGGGCAAGTTCGAGACCGATGCCATCAAGGAC
TTCATCAAGACGTCTGCCACTCCACTCGTCGGTGAAGTCGGCCCCGAGACGTACGCCGCCTACATGTCAGCTGGT
CTCCCTCTTGGCTACATCTTCGCCGAGACGCAAGAGCAGCGCGACACCCTGGCCAAGGATCTCAAGCCCGTGGCT
GAGAAGTACAAGGGCAAGCTCAACCTCGCCACCATTGACGCAAAGCAGTTCGGCGCCCACGCCGGCAACCTCAAC
CTCAAGACGGACAAGTTCCCCTGCTTCGCCATCCAGGATACTACCAACAACAAGAAGTACCCATTCGACCAGGAC
AAGGAGCTCGGCCACGACAACATTGCCAAATTCGTCGCCGACTTCGTCGCCGGCAAGATCGAGCCCAGCATCAAG
TCGGAGCCCATCCCGGAGAAGCAAGAGGGCCCCGTCACCGTCGTCGTCGCCAAGAACTACGAGAAGATCGTCAAC
GACGAGGACAAGGACGTGCTGCTCGAATTCTACGCTCCCTGGTGCGGTCACTGCAAGGCTCTGGCCCCCAAGTAC
GAGCAGCTGGCCTCGGCGTACGCCGACAGCGATTTCAAGGACAAGGTCGTCATCGCAAAGGTCGACGCCACCGCA
AACGACGTGCCCGACGACGTCGCCGGCTTCCCCACCATCAAGCTGTACCCCGCCGGCGCCAAGGGCGAACCCATC
ACCTACAGCGGCTCTCGTACCGTCGAAGATCTCGTCACATTTATCAAGGAGAACGGCAAGTTCAAGGCCGGCGTC
TCCATCAAGGCCGAGGGCACCGACGAGGCCGCTCCCGCCGCGACCGAGAAGGACGCCAAGAAGGACAAGGAGGCT
GATGAGGTCAAGGAGGAGCACGACGAGCTGTAA
Transcript >Ophcf2|04361
ATGCATCAGAAACGCCTTGCTCTAAGCCTCGCGTCTGCCCTTGCGGGCGTCGCCTATGCCGCCGACTCTTCCGAC
GTCCACCAGCTGACGGGCAAGGACTTTAAAGACTTTATCCATGGCCACAAGGACACTCTGGTGCTGACAAAGTTC
TATGCTCCCTGGTGTGGCCACTGCAAGGCCCTGGCCCCGGAGTTTGAGGCGGCCGCAAAGACGCTCAAGCCCAGG
TCCATCAAGCTGGCCAAGATCGATTGCACAGAGGAGGCCGATCTTTGCAAGCAGTATGAAGTCGAGGGCTATCCT
ACTCTCAAAATCTTCCAGGGCATCGACAATGTCTCGCCCTACAACGGCCAGCGGAAGGCTGATAGCATTCACTCT
TACATGGTGAAGCGCTCGTTGCCCGCCGTTTCCACACTTGCCAAGGATACCCTCGAGGACTTCAAGACGGCTGAC
AAGGTCGTCGTCATTGCCTACCTGGCCGCCGACGACAAGGAGTCCAACGCTTCTTTCTCCGCCGTCGCCGATTCC
ATGCGTGATGAGTACATGTTTGGTGGCGTCAACGACGAGGCTCTTGCCGAGGCTGAGGGCGTCAAGTTCCCTTCT
CTCGTCCTGTACAAGTCATTTGACGAGGGTAAGAACGACTTCAAGGGCAAGTTCGAGACCGATGCCATCAAGGAC
TTCATCAAGACGTCTGCCACTCCACTCGTCGGTGAAGTCGGCCCCGAGACGTACGCCGCCTACATGTCAGCTGGT
CTCCCTCTTGGCTACATCTTCGCCGAGACGCAAGAGCAGCGCGACACCCTGGCCAAGGATCTCAAGCCCGTGGCT
GAGAAGTACAAGGGCAAGCTCAACCTCGCCACCATTGACGCAAAGCAGTTCGGCGCCCACGCCGGCAACCTCAAC
CTCAAGACGGACAAGTTCCCCTGCTTCGCCATCCAGGATACTACCAACAACAAGAAGTACCCATTCGACCAGGAC
AAGGAGCTCGGCCACGACAACATTGCCAAATTCGTCGCCGACTTCGTCGCCGGCAAGATCGAGCCCAGCATCAAG
TCGGAGCCCATCCCGGAGAAGCAAGAGGGCCCCGTCACCGTCGTCGTCGCCAAGAACTACGAGAAGATCGTCAAC
GACGAGGACAAGGACGTGCTGCTCGAATTCTACGCTCCCTGGTGCGGTCACTGCAAGGCTCTGGCCCCCAAGTAC
GAGCAGCTGGCCTCGGCGTACGCCGACAGCGATTTCAAGGACAAGGTCGTCATCGCAAAGGTCGACGCCACCGCA
AACGACGTGCCCGACGACGTCGCCGGCTTCCCCACCATCAAGCTGTACCCCGCCGGCGCCAAGGGCGAACCCATC
ACCTACAGCGGCTCTCGTACCGTCGAAGATCTCGTCACATTTATCAAGGAGAACGGCAAGTTCAAGGCCGGCGTC
TCCATCAAGGCCGAGGGCACCGACGAGGCCGCTCCCGCCGCGACCGAGAAGGACGCCAAGAAGGACAAGGAGGCT
GATGAGGTCAAGGAGGAGCACGACGAGCTGTAA
Gene >Ophcf2|04361
ATGCATCAGAAACGCCTTGCTCTAAGCCTCGCGTCTGCCCTTGCGGGCGTCGCCTATGCCGCCGACTCTTCCGAC
GTCCACCAGCTGACGGGCAAGGACTTTAAAGACTTTATCCATGGCCACAAGGACACTCTGGTGCTGACAAAGTGT
GAGTGATTCTACCCTTGGCTGCTTTCTCCGATGCTGACTTGGCTCCAGTCTATGCTCCCTGGTGTGGCCACTGCA
AGGCCCTGGCCCCGGAGTTTGAGGCGGCCGCAAAGACGCTCAAGCCCAGGTCCATCAAGCTGGCCAAGATCGATT
GCACAGAGGAGGCCGATCTTTGCAAGCAGTATGAAGTCGAGGGCTATCCTACTCTCAAAATCTTCCAGGGCATCG
ACAATGTCTCGCCCTACAACGGCCAGCGGAAGGCTGATAGGTATGTCGGACCACGTGTTCTGTCGCTCGAGCCGC
CATTACTGACCGCTACTGCCTCCAGCATTCACTCTTACATGGTGAAGCGCTCGTTGCCCGCCGTTTCCACACTTG
CCAAGGATACCCTCGAGGACTTCAAGACGGCTGACAAGGTCGTCGTCATTGCCTACCTGGCCGCCGACGACAAGG
AGTCCAACGCTTCTTTCTCCGCCGTCGCCGATTCCATGCGTGATGAGTACATGTTTGGTGGCGTCAACGACGAGG
CTCTTGCCGAGGCTGAGGGCGTCAAGTTCCCTTCTCTCGTCCTGTACAAGTCATTTGACGAGGGTAAGAACGACT
TCAAGGGCAAGTTCGAGACCGATGCCATCAAGGACTTCATCAAGACGTCTGCCACTCCACTCGTCGGTGAAGTCG
GCCCCGAGACGTACGCCGCCTACATGTCAGCTGGTCTCCCTCTTGGCTACATCTTCGCCGAGACGCAAGAGCAGC
GCGACACCCTGGCCAAGGATCTCAAGCCCGTGGCTGAGAAGTACAAGGGCAAGCTCAACCTCGCCACCATTGACG
CAAAGCAGTTCGGCGCCCACGCCGGCAACCTCAACCTCAAGACGGACAAGTTCCCCTGCTTCGCCATCCAGGATA
CTACCAACAACAAGAAGTACCCATTCGACCAGGACAAGGAGCTCGGCCACGACAACATTGCCAAATTCGTCGCCG
ACTTCGTCGCCGGCAAGATCGAGCCCAGCATCAAGTCGGAGCCCATCCCGGAGAAGCAAGAGGGCCCCGTCACCG
TCGTCGTCGCCAAGAACTACGAGAAGATCGTCAACGACGAGGACAAGGACGTGCTGCTCGAATTCTACGCTCCCT
GGTGCGGTCACTGCAAGGCTCTGGCCCCCAAGTACGAGCAGCTGGCCTCGGCGTACGCCGACAGCGATTTCAAGG
ACAAGGTCGTCATCGCAAAGGTCGACGCCACCGCAAACGACGTGCCCGACGACGTCGCCGGCTTCCCCACCATCA
AGCTGTACCCCGCCGGCGCCAAGGGCGAACCCATCACCTACAGCGGCTCTCGTACCGTCGAAGATCTCGTCACAT
TTATCAAGGAGAACGGCAAGTTCAAGGCCGGCGTCTCCATCAAGGCCGAGGGCACCGACGAGGCCGCTCCCGCCG
CGACCGAGAAGGACGCCAAGAAGGACAAGGAGGCTGATGAGGTCAAGGAGGAGCACGACGAGCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail