Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04355
Gene name
Locationscaffold_04:3017726..3020861
Strand-
Gene length (bp)3135
Transcript length (bp)3075
Coding sequence length (bp)3075
Protein length (aa) 1025

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 4.1E-53 522 884

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0004540 ribonuclease activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:1901363 heterocyclic compound binding No
GO:0004518 nuclease activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0003676 nucleic acid binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1536 0.1225 0.1434 0.0482 0.8784 0.0253 0.0459 0.0504 0.1064 0.0057

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3762
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7206
Ophiocordyceps australis map64 (Brazil) OphauB2|2261
Ophiocordyceps camponoti-floridani Ophcf2|04355 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3035
Ophiocordyceps kimflemingae Ophio5|6899
Ophiocordyceps subramaniannii Hirsu2|7339

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04355
MLSRLHRRPVCILCLAPARVLVTGRIASLPLASGVRLYSPLPTYEPNESRLWQEPPKRGLPIRETLRKWEEENES
LGSENLPSDLPPEGELSNCLTRTQTTGAQGLVIISNRDVGLSQNAIGEGQPDEVASTSSSADCRIPGNLVELKSI
GSRVSNLAIYIGYFGGCYHFFSVNGTWMLSMSFPTAFTVTRFAPPDLLDSILEKIPEDGTPEFYFDLQSRSKGPK
REDGEILMNLMADFRTEANVVYARHIGELDNIQQIVPRTSDVEYLSLVEVADRILPATLRLGDGSFPPHVLYAVF
KGLTSQDIACPSVNTAADCRRPDHLFEIYPPAYALIVDKVSEMVREYVSDVMSKEKPAGSAFTTTKLPPNIQLLT
TPLLTFIKEARHVVLQSRRHRTPSSCGLIKPSSAIELEKPNFSATSREVLKFLEYWSVYNIFAPECRLHSHGATI
LRALDLYPDRDLNQGTAWLFLQEAGILSPWELPSRFKHRMPGVPVDKNGGLSRPAPRALEESMRPDIAAGHRRDR
RGETVFCIDAASTSLIDDGVSLERTKWDTEFWIHIHVADPASRLLPNSEVSKYIELLPENVYLPGHYDAMIPSHL
GLKSTDPTSESLVQQFSLRPGGPAFTFSARVNRAGDVLDSKIEPCTLGDVVYLAPEDVANFCDQPPPPPLDEKMK
RRLAVGNRKESTWPLRQMDETDGLTVAQKDDLTTLYQLAEAIKQKRLSKGAWPHYFPKPSVSVGFEASSGEKPPQ
GAKLIPADPYIEVGTDLSIHSTVVSSLMVLAGEVAASWCAQRSIPIPYRRNTKAANNMEDAYEYATEVLYPLVRK
GIRPTPQQQHMLTLLTGDIELSPRPGPYFLMGIDMYTKATSPLRRFGDLLVHWQIHAALAFEREHGRKLNQSKDD
LAAILPFTASGLNLPWLKIRERTARRIGSGSLDWTLIALARAWLFEGKKIGQLRFRVRATWARGLLGQLDLFDVP
ARLDVEELGDCRLLKDTKIGDEFAVELVDVNVYSRNAFVKALQYLGGGG*
Coding >Ophcf2|04355
ATGCTGTCGAGGCTCCATCGCCGGCCAGTATGCATCCTATGTCTGGCTCCTGCCCGCGTGCTGGTCACGGGTCGA
ATCGCCTCGCTGCCCTTGGCCTCTGGCGTCCGCCTTTACTCGCCTCTGCCCACGTACGAACCGAACGAATCCCGT
CTCTGGCAAGAGCCTCCAAAACGCGGTCTCCCCATCCGAGAGACTCTGCGCAAGTGGGAGGAGGAGAATGAATCC
CTGGGCTCGGAAAACTTGCCCAGCGATCTGCCGCCCGAAGGCGAATTGTCCAACTGCTTGACCCGCACTCAGACG
ACAGGAGCTCAAGGGCTTGTCATCATCTCTAATCGCGATGTCGGACTGTCGCAGAACGCTATTGGAGAGGGTCAA
CCGGACGAAGTGGCCTCGACTTCTTCTTCTGCGGACTGTCGCATCCCCGGCAATCTTGTCGAACTCAAGTCCATT
GGCTCCCGCGTCTCCAATCTCGCCATCTATATCGGATACTTTGGCGGCTGCTATCATTTCTTCTCCGTCAATGGC
ACTTGGATGCTTTCCATGAGCTTTCCCACCGCCTTCACCGTCACTCGATTCGCCCCCCCCGACCTCCTCGACTCG
ATCCTAGAAAAGATCCCCGAAGATGGGACCCCGGAATTTTATTTCGACTTGCAGTCCAGGAGCAAAGGACCGAAG
CGAGAAGACGGCGAGATATTGATGAACCTAATGGCAGATTTCAGAACCGAGGCCAACGTCGTCTATGCTAGACAC
ATTGGCGAACTCGACAACATCCAGCAAATTGTGCCTCGAACGAGTGACGTCGAGTATCTCAGCCTCGTCGAGGTA
GCCGATCGCATTCTGCCGGCCACGCTGAGACTAGGCGACGGCTCGTTCCCTCCCCACGTGCTCTACGCCGTCTTC
AAAGGCTTGACCAGTCAGGATATCGCCTGCCCTTCTGTCAACACTGCTGCAGACTGTCGCCGTCCCGACCATCTG
TTCGAGATCTATCCGCCGGCCTACGCCCTGATCGTCGATAAGGTCTCGGAAATGGTCCGTGAATACGTCAGCGAT
GTCATGTCGAAAGAAAAACCGGCCGGCTCAGCATTCACCACCACAAAACTGCCTCCCAACATCCAGCTGTTGACG
ACGCCCCTCTTGACATTTATAAAAGAAGCTCGTCATGTCGTTCTCCAGAGTCGTCGCCATCGCACTCCCTCGTCC
TGCGGTTTGATCAAGCCTTCATCAGCCATCGAATTGGAGAAGCCAAACTTTTCTGCCACCAGCAGAGAGGTCCTC
AAGTTCCTCGAGTATTGGTCGGTCTACAACATCTTTGCTCCCGAATGCCGACTTCACTCGCACGGGGCCACCATC
CTTCGTGCCCTGGATCTGTACCCGGACAGGGATCTCAACCAAGGCACGGCCTGGCTGTTTCTGCAAGAAGCCGGC
ATCCTCTCCCCGTGGGAGCTGCCGTCTCGTTTCAAGCATCGAATGCCGGGTGTTCCCGTCGATAAGAACGGGGGG
TTGAGCCGCCCAGCGCCCAGGGCCCTCGAGGAGTCGATGAGACCGGATATAGCCGCCGGACACAGGAGAGACAGA
CGGGGCGAGACCGTCTTCTGCATCGATGCGGCCTCGACAAGCCTCATTGATGATGGTGTGTCTCTGGAGCGCACG
AAATGGGATACTGAATTCTGGATTCACATCCACGTTGCCGATCCGGCATCGAGACTGCTGCCAAATTCCGAGGTC
AGCAAATACATCGAGCTCTTACCAGAGAACGTCTATCTCCCAGGGCATTACGATGCCATGATACCCAGCCACCTG
GGGCTGAAATCGACCGACCCGACGTCCGAGAGCCTTGTCCAGCAGTTTTCCCTACGTCCAGGGGGACCGGCCTTT
ACATTCAGCGCGAGGGTGAACCGAGCCGGCGACGTGCTCGACAGCAAGATTGAGCCGTGCACGCTCGGAGACGTC
GTCTACCTGGCACCCGAAGACGTGGCCAATTTCTGCGACCAGCCGCCGCCGCCGCCTCTGGACGAAAAGATGAAA
AGGCGGCTTGCGGTGGGAAACCGGAAAGAATCGACCTGGCCTCTGCGACAGATGGACGAAACGGACGGCCTGACG
GTGGCGCAGAAAGATGATCTCACGACCCTCTACCAGCTGGCCGAGGCCATCAAGCAGAAGAGGCTGTCCAAGGGC
GCCTGGCCGCACTACTTTCCCAAGCCGTCGGTGTCGGTCGGCTTCGAGGCCAGCTCGGGAGAGAAGCCGCCGCAG
GGAGCCAAGCTGATTCCGGCGGATCCGTATATCGAGGTGGGCACCGACCTTTCCATACACAGCACCGTCGTCTCC
AGCTTGATGGTGCTGGCCGGAGAGGTGGCGGCAAGCTGGTGCGCGCAGCGCAGCATCCCAATCCCGTACCGCAGA
AACACCAAAGCGGCCAACAACATGGAGGACGCGTACGAGTACGCAACCGAGGTCCTCTATCCCCTGGTCCGGAAG
GGTATCCGGCCGACACCGCAGCAGCAGCACATGCTCACGTTGCTCACGGGAGATATTGAACTTTCGCCGAGGCCC
GGGCCGTACTTTCTCATGGGCATCGACATGTACACCAAGGCCACGTCCCCTTTGCGTCGCTTTGGGGACCTACTC
GTTCACTGGCAGATCCACGCGGCGCTGGCGTTTGAGAGGGAACACGGCCGGAAGCTGAACCAGTCCAAGGACGAC
CTGGCCGCCATCCTGCCCTTTACCGCGAGCGGGCTGAACCTGCCGTGGCTGAAGATACGGGAGAGGACGGCGCGG
CGGATCGGCAGCGGATCGCTCGACTGGACGCTCATTGCCCTGGCTCGGGCCTGGCTCTTTGAGGGTAAGAAGATT
GGCCAGCTGAGGTTCCGGGTCAGGGCGACCTGGGCCCGTGGCTTGCTCGGCCAACTCGATCTCTTTGACGTGCCG
GCGCGGCTCGACGTTGAGGAACTGGGCGACTGCCGTCTTCTCAAGGATACGAAGATTGGGGATGAGTTTGCGGTT
GAGCTGGTGGATGTCAACGTCTACAGCCGGAACGCCTTTGTCAAGGCGCTGCAGTATCTCGGTGGTGGCGGCTAG
Transcript >Ophcf2|04355
ATGCTGTCGAGGCTCCATCGCCGGCCAGTATGCATCCTATGTCTGGCTCCTGCCCGCGTGCTGGTCACGGGTCGA
ATCGCCTCGCTGCCCTTGGCCTCTGGCGTCCGCCTTTACTCGCCTCTGCCCACGTACGAACCGAACGAATCCCGT
CTCTGGCAAGAGCCTCCAAAACGCGGTCTCCCCATCCGAGAGACTCTGCGCAAGTGGGAGGAGGAGAATGAATCC
CTGGGCTCGGAAAACTTGCCCAGCGATCTGCCGCCCGAAGGCGAATTGTCCAACTGCTTGACCCGCACTCAGACG
ACAGGAGCTCAAGGGCTTGTCATCATCTCTAATCGCGATGTCGGACTGTCGCAGAACGCTATTGGAGAGGGTCAA
CCGGACGAAGTGGCCTCGACTTCTTCTTCTGCGGACTGTCGCATCCCCGGCAATCTTGTCGAACTCAAGTCCATT
GGCTCCCGCGTCTCCAATCTCGCCATCTATATCGGATACTTTGGCGGCTGCTATCATTTCTTCTCCGTCAATGGC
ACTTGGATGCTTTCCATGAGCTTTCCCACCGCCTTCACCGTCACTCGATTCGCCCCCCCCGACCTCCTCGACTCG
ATCCTAGAAAAGATCCCCGAAGATGGGACCCCGGAATTTTATTTCGACTTGCAGTCCAGGAGCAAAGGACCGAAG
CGAGAAGACGGCGAGATATTGATGAACCTAATGGCAGATTTCAGAACCGAGGCCAACGTCGTCTATGCTAGACAC
ATTGGCGAACTCGACAACATCCAGCAAATTGTGCCTCGAACGAGTGACGTCGAGTATCTCAGCCTCGTCGAGGTA
GCCGATCGCATTCTGCCGGCCACGCTGAGACTAGGCGACGGCTCGTTCCCTCCCCACGTGCTCTACGCCGTCTTC
AAAGGCTTGACCAGTCAGGATATCGCCTGCCCTTCTGTCAACACTGCTGCAGACTGTCGCCGTCCCGACCATCTG
TTCGAGATCTATCCGCCGGCCTACGCCCTGATCGTCGATAAGGTCTCGGAAATGGTCCGTGAATACGTCAGCGAT
GTCATGTCGAAAGAAAAACCGGCCGGCTCAGCATTCACCACCACAAAACTGCCTCCCAACATCCAGCTGTTGACG
ACGCCCCTCTTGACATTTATAAAAGAAGCTCGTCATGTCGTTCTCCAGAGTCGTCGCCATCGCACTCCCTCGTCC
TGCGGTTTGATCAAGCCTTCATCAGCCATCGAATTGGAGAAGCCAAACTTTTCTGCCACCAGCAGAGAGGTCCTC
AAGTTCCTCGAGTATTGGTCGGTCTACAACATCTTTGCTCCCGAATGCCGACTTCACTCGCACGGGGCCACCATC
CTTCGTGCCCTGGATCTGTACCCGGACAGGGATCTCAACCAAGGCACGGCCTGGCTGTTTCTGCAAGAAGCCGGC
ATCCTCTCCCCGTGGGAGCTGCCGTCTCGTTTCAAGCATCGAATGCCGGGTGTTCCCGTCGATAAGAACGGGGGG
TTGAGCCGCCCAGCGCCCAGGGCCCTCGAGGAGTCGATGAGACCGGATATAGCCGCCGGACACAGGAGAGACAGA
CGGGGCGAGACCGTCTTCTGCATCGATGCGGCCTCGACAAGCCTCATTGATGATGGTGTGTCTCTGGAGCGCACG
AAATGGGATACTGAATTCTGGATTCACATCCACGTTGCCGATCCGGCATCGAGACTGCTGCCAAATTCCGAGGTC
AGCAAATACATCGAGCTCTTACCAGAGAACGTCTATCTCCCAGGGCATTACGATGCCATGATACCCAGCCACCTG
GGGCTGAAATCGACCGACCCGACGTCCGAGAGCCTTGTCCAGCAGTTTTCCCTACGTCCAGGGGGACCGGCCTTT
ACATTCAGCGCGAGGGTGAACCGAGCCGGCGACGTGCTCGACAGCAAGATTGAGCCGTGCACGCTCGGAGACGTC
GTCTACCTGGCACCCGAAGACGTGGCCAATTTCTGCGACCAGCCGCCGCCGCCGCCTCTGGACGAAAAGATGAAA
AGGCGGCTTGCGGTGGGAAACCGGAAAGAATCGACCTGGCCTCTGCGACAGATGGACGAAACGGACGGCCTGACG
GTGGCGCAGAAAGATGATCTCACGACCCTCTACCAGCTGGCCGAGGCCATCAAGCAGAAGAGGCTGTCCAAGGGC
GCCTGGCCGCACTACTTTCCCAAGCCGTCGGTGTCGGTCGGCTTCGAGGCCAGCTCGGGAGAGAAGCCGCCGCAG
GGAGCCAAGCTGATTCCGGCGGATCCGTATATCGAGGTGGGCACCGACCTTTCCATACACAGCACCGTCGTCTCC
AGCTTGATGGTGCTGGCCGGAGAGGTGGCGGCAAGCTGGTGCGCGCAGCGCAGCATCCCAATCCCGTACCGCAGA
AACACCAAAGCGGCCAACAACATGGAGGACGCGTACGAGTACGCAACCGAGGTCCTCTATCCCCTGGTCCGGAAG
GGTATCCGGCCGACACCGCAGCAGCAGCACATGCTCACGTTGCTCACGGGAGATATTGAACTTTCGCCGAGGCCC
GGGCCGTACTTTCTCATGGGCATCGACATGTACACCAAGGCCACGTCCCCTTTGCGTCGCTTTGGGGACCTACTC
GTTCACTGGCAGATCCACGCGGCGCTGGCGTTTGAGAGGGAACACGGCCGGAAGCTGAACCAGTCCAAGGACGAC
CTGGCCGCCATCCTGCCCTTTACCGCGAGCGGGCTGAACCTGCCGTGGCTGAAGATACGGGAGAGGACGGCGCGG
CGGATCGGCAGCGGATCGCTCGACTGGACGCTCATTGCCCTGGCTCGGGCCTGGCTCTTTGAGGGTAAGAAGATT
GGCCAGCTGAGGTTCCGGGTCAGGGCGACCTGGGCCCGTGGCTTGCTCGGCCAACTCGATCTCTTTGACGTGCCG
GCGCGGCTCGACGTTGAGGAACTGGGCGACTGCCGTCTTCTCAAGGATACGAAGATTGGGGATGAGTTTGCGGTT
GAGCTGGTGGATGTCAACGTCTACAGCCGGAACGCCTTTGTCAAGGCGCTGCAGTATCTCGGTGGTGGCGGCTAG
Gene >Ophcf2|04355
ATGCTGTCGAGGCTCCATCGCCGGCCAGTATGCATCCTATGTCTGGCTCCTGCCCGCGTGCTGGTCACGGGTCGA
ATCGCCTCGCTGCCCTTGGCCTCTGGCGTCCGCCTTTACTCGCCTCTGCCCACGTACGAACCGAACGAATCCCGT
CTCTGGCAAGAGCCTCCAAAACGCGGTCTCCCCATCCGAGAGACTCTGCGCAAGTGGGAGGAGGAGAATGAATCC
CTGGGCTCGGAAAACTTGCCCAGCGATCTGCCGCCCGAAGGCGAATTGTCCAACTGCTTGACCCGCACTCAGACG
ACAGGAGCTCAAGGGCTTGTCATCATCTCTAATCGCGATGTCGGACTGTCGCAGAACGCTATTGGAGAGGGTCAA
CCGGACGAAGTGGCCTCGACTTCTTCTTCTGCGGACTGTCGCATCCCCGGCAATCTTGTCGAACTCAAGTCCTCT
CTCCCCACCCCCTTCTTTGGAGTCTCGGAGCGTCTGAGCTAACTTGTCGCCAGGTCCATTGGCTCCCGCGTCTCC
AATCTCGCCATCTATATCGGATACTTTGGCGGCTGCTATCATTTCTTCTCCGTCAATGGCACTTGGATGCTTTCC
ATGAGCTTTCCCACCGCCTTCACCGTCACTCGATTCGCCCCCCCCGACCTCCTCGACTCGATCCTAGAAAAGATC
CCCGAAGATGGGACCCCGGAATTTTATTTCGACTTGCAGTCCAGGAGCAAAGGACCGAAGCGAGAAGACGGCGAG
ATATTGATGAACCTAATGGCAGATTTCAGAACCGAGGCCAACGTCGTCTATGCTAGACACATTGGCGAACTCGAC
AACATCCAGCAAATTGTGCCTCGAACGAGTGACGTCGAGTATCTCAGCCTCGTCGAGGTAGCCGATCGCATTCTG
CCGGCCACGCTGAGACTAGGCGACGGCTCGTTCCCTCCCCACGTGCTCTACGCCGTCTTCAAAGGCTTGACCAGT
CAGGATATCGCCTGCCCTTCTGTCAACACTGCTGCAGACTGTCGCCGTCCCGACCATCTGTTCGAGATCTATCCG
CCGGCCTACGCCCTGATCGTCGATAAGGTCTCGGAAATGGTCCGTGAATACGTCAGCGATGTCATGTCGAAAGAA
AAACCGGCCGGCTCAGCATTCACCACCACAAAACTGCCTCCCAACATCCAGCTGTTGACGACGCCCCTCTTGACA
TTTATAAAAGAAGCTCGTCATGTCGTTCTCCAGAGTCGTCGCCATCGCACTCCCTCGTCCTGCGGTTTGATCAAG
CCTTCATCAGCCATCGAATTGGAGAAGCCAAACTTTTCTGCCACCAGCAGAGAGGTCCTCAAGTTCCTCGAGTAT
TGGTCGGTCTACAACATCTTTGCTCCCGAATGCCGACTTCACTCGCACGGGGCCACCATCCTTCGTGCCCTGGAT
CTGTACCCGGACAGGGATCTCAACCAAGGCACGGCCTGGCTGTTTCTGCAAGAAGCCGGCATCCTCTCCCCGTGG
GAGCTGCCGTCTCGTTTCAAGCATCGAATGCCGGGTGTTCCCGTCGATAAGAACGGGGGGTTGAGCCGCCCAGCG
CCCAGGGCCCTCGAGGAGTCGATGAGACCGGATATAGCCGCCGGACACAGGAGAGACAGACGGGGCGAGACCGTC
TTCTGCATCGATGCGGCCTCGACAAGCCTCATTGATGATGGTGTGTCTCTGGAGCGCACGAAATGGGATACTGAA
TTCTGGATTCACATCCACGTTGCCGATCCGGCATCGAGACTGCTGCCAAATTCCGAGGTCAGCAAATACATCGAG
CTCTTACCAGAGAACGTCTATCTCCCAGGGCATTACGATGCCATGATACCCAGCCACCTGGGGCTGAAATCGACC
GACCCGACGTCCGAGAGCCTTGTCCAGCAGTTTTCCCTACGTCCAGGGGGACCGGCCTTTACATTCAGCGCGAGG
GTGAACCGAGCCGGCGACGTGCTCGACAGCAAGATTGAGCCGTGCACGCTCGGAGACGTCGTCTACCTGGCACCC
GAAGACGTGGCCAATTTCTGCGACCAGCCGCCGCCGCCGCCTCTGGACGAAAAGATGAAAAGGCGGCTTGCGGTG
GGAAACCGGAAAGAATCGACCTGGCCTCTGCGACAGATGGACGAAACGGACGGCCTGACGGTGGCGCAGAAAGAT
GATCTCACGACCCTCTACCAGCTGGCCGAGGCCATCAAGCAGAAGAGGCTGTCCAAGGGCGCCTGGCCGCACTAC
TTTCCCAAGCCGTCGGTGTCGGTCGGCTTCGAGGCCAGCTCGGGAGAGAAGCCGCCGCAGGGAGCCAAGCTGATT
CCGGCGGATCCGTATATCGAGGTGGGCACCGACCTTTCCATACACAGCACCGTCGTCTCCAGCTTGATGGTGCTG
GCCGGAGAGGTGGCGGCAAGCTGGTGCGCGCAGCGCAGCATCCCAATCCCGTACCGCAGAAACACCAAAGCGGCC
AACAACATGGAGGACGCGTACGAGTACGCAACCGAGGTCCTCTATCCCCTGGTCCGGAAGGGTATCCGGCCGACA
CCGCAGCAGCAGCACATGCTCACGTTGCTCACGGGAGATATTGAACTTTCGCCGAGGCCCGGGCCGTACTTTCTC
ATGGGCATCGACATGTACACCAAGGCCACGTCCCCTTTGCGTCGCTTTGGGGACCTACTCGTTCACTGGCAGATC
CACGCGGCGCTGGCGTTTGAGAGGGAACACGGCCGGAAGCTGAACCAGTCCAAGGACGACCTGGCCGCCATCCTG
CCCTTTACCGCGAGCGGGCTGAACCTGCCGTGGCTGAAGATACGGGAGAGGACGGCGCGGCGGATCGGCAGCGGA
TCGCTCGACTGGACGCTCATTGCCCTGGCTCGGGCCTGGCTCTTTGAGGGTAAGAAGATTGGCCAGCTGAGGTTC
CGGGTCAGGGCGACCTGGGCCCGTGGCTTGCTCGGCCAACTCGATCTCTTTGACGTGCCGGCGCGGCTCGACGTT
GAGGAACTGGGCGACTGCCGTCTTCTCAAGGATACGAAGATTGGGGATGAGTTTGCGGTTGAGCTGGTGGATGTC
AACGTCTACAGCCGGAACGCCTTTGTCAAGGCGCTGCAGTATCTCGGTGGTGGCGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail