Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04354
Gene name
Locationscaffold_04:3015093..3016174
Strand-
Gene length (bp)1081
Transcript length (bp)588
Coding sequence length (bp)588
Protein length (aa) 196

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 5.3E-55 7 178
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 3.4E-21 7 120
PF00025 Arf ADP-ribosylation factor family 1.5E-06 6 172

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole 0.3448 0.1943 0.024 0.7111 0.2007 0.0502 0.3632 0.6448 0.597 0.1525

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1161
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4706
Ophiocordyceps australis map64 (Brazil) OphauB2|6285
Ophiocordyceps camponoti-floridani Ophcf2|04354 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3034
Ophiocordyceps kimflemingae Ophio5|2967
Ophiocordyceps subramaniannii Hirsu2|10251

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04354
MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGKRVELALWDTAGQEDYDRLRPLSYP
DSHVILICFAIDSPDSLDNVQEKWISEVLHFCQGLPIILVGCKKDLRYDQKTIEELRKTSQKPVSPEDGEEVRKK
ISAYKYLECSAKTNEGVRDVFEHATRAALLSRAKGKNGRKKCLVL*
Coding >Ophcf2|04354
ATGGCTGAAATCCGTCGAAAGCTCGTCATCGTTGGCGATGGTGCCTGCGGGAAAACCTGCTTGTTGATTGTCTTT
TCCAAGGGCACGTTTCCCGAGGTCTACGTCCCCACCGTCTTCGAAAATTACGTGGCCGATGTCGAGGTCGACGGC
AAACGCGTCGAGTTGGCTCTATGGGATACGGCTGGTCAGGAGGACTACGACCGGCTCCGCCCTCTCTCGTATCCC
GACTCGCACGTCATTTTGATCTGCTTTGCCATCGACTCGCCCGATTCGCTCGATAACGTCCAGGAAAAGTGGATC
TCCGAGGTCCTTCACTTTTGTCAGGGTCTGCCCATCATCCTGGTCGGCTGCAAGAAGGATTTGCGGTACGATCAG
AAGACGATCGAGGAGCTGCGCAAGACGAGTCAGAAGCCCGTCTCACCCGAAGACGGCGAGGAAGTCCGCAAGAAG
ATCTCGGCCTACAAGTATCTCGAGTGCTCGGCCAAGACCAACGAGGGCGTGCGCGACGTTTTCGAGCATGCCACG
CGGGCCGCTCTCCTATCGCGCGCCAAAGGCAAGAACGGACGCAAAAAGTGTCTTGTGCTGTAA
Transcript >Ophcf2|04354
ATGGCTGAAATCCGTCGAAAGCTCGTCATCGTTGGCGATGGTGCCTGCGGGAAAACCTGCTTGTTGATTGTCTTT
TCCAAGGGCACGTTTCCCGAGGTCTACGTCCCCACCGTCTTCGAAAATTACGTGGCCGATGTCGAGGTCGACGGC
AAACGCGTCGAGTTGGCTCTATGGGATACGGCTGGTCAGGAGGACTACGACCGGCTCCGCCCTCTCTCGTATCCC
GACTCGCACGTCATTTTGATCTGCTTTGCCATCGACTCGCCCGATTCGCTCGATAACGTCCAGGAAAAGTGGATC
TCCGAGGTCCTTCACTTTTGTCAGGGTCTGCCCATCATCCTGGTCGGCTGCAAGAAGGATTTGCGGTACGATCAG
AAGACGATCGAGGAGCTGCGCAAGACGAGTCAGAAGCCCGTCTCACCCGAAGACGGCGAGGAAGTCCGCAAGAAG
ATCTCGGCCTACAAGTATCTCGAGTGCTCGGCCAAGACCAACGAGGGCGTGCGCGACGTTTTCGAGCATGCCACG
CGGGCCGCTCTCCTATCGCGCGCCAAAGGCAAGAACGGACGCAAAAAGTGTCTTGTGCTGTAA
Gene >Ophcf2|04354
ATGGCTGAAATCCGTCGAAAGCTCGTCATCGTTGGCGATGGTGCCTGCGGGAAAACCTGCTTGTTGATGTGAGTT
GCTCACCTCCGTTTGCGCGTGGCAAACGAGTGTTTTTTTTTTTTTTCGGAAGGGTCTGTTTGTCATGGGCTGATG
GGCTTTGCAGTGTCTTTTCCAAGGGCACGTTTCCCGAGGTAAGAAGAATTGATGAGGCCTCCGCATTTTGCCCTT
TTCCCCTCCTTTTTTCCCTTCTTTCACCACGTCTTCTCTCTCGGATGGTTGCCGTCGCGCTTCTTGATGGAACTG
AGGTCTCATGTGCCGACTTTTGTCGCCCATGAAGCCCATACTCTTTCCTCGACGCGTCTCGGCAGTCTTTCACCC
TTTCCCCTTACCCTCTCCCCTCTTCCACCCCCCCCCTCACCTAATTTTTTTGTTATTCTTTGTGCTAATCACTCT
CAGGTCTACGTCCCCACCGTCTTCGAAAATTACGTGGCCGATGTCGAGGTCGACGGCAAACGCGTCGAGTTGGCT
CTATGGGATACGGCTGGTCAGGAGGACTACGACCGGCTCCGCCCTCTCTCGTATCCCGACTCGCACGTCATTTTG
ATCTGCTTTGCCATCGACTCGCCCGATTCGCTCGATAACGTCCAGGAAAAGGTATGGTGATTCCCGTCGAGTAAA
GGGTTCGGTTGCTGACTGGCATCGTCTCGCAGTGGATCTCCGAGGTCCTTCACTTTTGTCAGGGTCTGCCCATCA
TCCTGGTCGGCTGCAAGAAGGATTTGCGGTACGATCAGAAGACGATCGAGGAGCTGCGCAAGACGAGTCAGAAGC
CCGTCTCACCCGAAGACGTGAGTTTTCTTCTTGTTCTTCTTTTTCTTCTTCTTACGTATCCCATCACCGAGGACG
CTCGCTGACGTGGTCGTTACAGGGCGAGGAAGTCCGCAAGAAGATCTCGGCCTACAAGTATCTCGAGTGCTCGGC
CAAGACCAACGAGGGCGTGCGCGACGTTTTCGAGCATGCCACGCGGGCCGCTCTCCTATCGCGCGCCAAAGGCAA
GAACGGACGCAAAAAGTGTCTTGTGCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail