Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04353
Gene name
Locationscaffold_04:3012444..3014094
Strand+
Gene length (bp)1650
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 2.0E-70 88 477

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 120 142 22
2 173 195 22
3 215 232 17
4 245 267 22
5 282 304 22
6 317 339 22
7 359 381 22
8 402 424 22
9 428 450 22
10 457 479 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04353
MRDDEGVLLERVVSGGGDDDEEEEEEEEEEEAMGHLETRPMLSSAADDDDDHRDESHEEDDDDDDVIILGQSQSS
HQVALPSTLQRPKSNLQSAFMNMANSIIGAGIIGQPYAFRQAGLLTGIILLVALTVVVDWTIRLIVINSKLSGTS
SFQGTVEHCFGRAGMVAISLAQWVFAFGGMVAFAVIVGDTIPHVLTAVWPRLPFVPVLGLLTDRRVAIIVFVMAV
SYPLTLYRDIAKLAKASTFALIGMIVIVTTVLIQGILVPSSARGTFTTPLLTLNTGVFQAIGVISFAFVCHHNSL
LIYGSLRTPTIDNFSRVTHYSTTVSMLACLTMALAGFLTFGDKTAGNVLNNFPPSNNMVNLARLFFGLNMLTTMP
LEALVCREVMLTYWFPDSAFDLKRHVLLSTGLVLSATALSLLTCDLGVVFELVGATSAVVMAYILPPLCYVRLAT
ATGWRTCVAYLVVVFGVAVMAISVLQAVASLVRGREAAACT*
Coding >Ophcf2|04353
ATGCGTGATGACGAGGGTGTTTTGCTAGAGAGGGTTGTTTCGGGGGGGGGTGATGATGATGAGGAGGAGGAGGAG
GAGGAGGAGGAGGAGGAGGCCATGGGGCATCTCGAGACGAGGCCGATGCTGTCCTCGGCCGCCGACGACGACGAC
GATCATCGTGACGAATCCCACGAGGAAGACGACGACGACGACGACGTTATAATCCTCGGACAATCTCAATCATCC
CACCAAGTTGCCCTCCCCTCCACCCTCCAACGCCCCAAATCCAACCTCCAATCGGCCTTCATGAACATGGCCAAC
TCCATCATCGGCGCCGGCATAATCGGCCAACCCTACGCCTTCCGCCAAGCCGGCCTCCTCACCGGCATAATCCTC
CTCGTCGCCCTCACCGTCGTCGTCGACTGGACCATCCGCCTCATCGTCATCAACAGCAAGCTCAGCGGCACCAGC
AGCTTCCAGGGCACCGTCGAGCATTGCTTCGGGAGGGCCGGCATGGTGGCCATCAGTTTGGCGCAGTGGGTTTTT
GCCTTTGGCGGCATGGTGGCTTTTGCCGTCATCGTGGGAGATACCATCCCTCACGTTCTTACCGCCGTCTGGCCG
CGTTTGCCTTTTGTTCCGGTGCTGGGCCTCTTGACGGATAGACGGGTGGCCATCATCGTCTTCGTCATGGCCGTC
AGCTATCCGCTGACATTGTACCGCGACATCGCCAAGCTGGCCAAAGCCAGCACCTTTGCCCTCATCGGCATGATA
GTCATCGTCACCACGGTCCTAATCCAAGGCATCCTCGTCCCCTCGTCAGCCCGCGGCACCTTCACAACCCCCCTC
CTAACGCTCAACACCGGCGTCTTCCAAGCCATCGGCGTGATATCCTTCGCCTTCGTCTGCCACCACAACTCCCTC
CTAATCTACGGGTCCCTCCGCACGCCAACAATAGACAACTTCTCCCGCGTAACCCACTACTCGACCACGGTCTCG
ATGCTAGCCTGCTTAACCATGGCCCTAGCCGGCTTCCTCACCTTTGGCGACAAAACAGCGGGCAACGTGCTCAAC
AACTTCCCCCCCTCGAACAACATGGTCAACCTCGCCCGCCTCTTCTTCGGCCTGAACATGCTCACGACGATGCCC
CTCGAAGCCTTGGTCTGCAGAGAGGTGATGCTGACCTACTGGTTCCCCGACTCGGCCTTCGACCTGAAACGGCAC
GTGCTCCTCAGCACCGGCCTCGTCCTCTCGGCCACGGCCCTCAGCCTGCTCACCTGCGACCTAGGCGTCGTCTTC
GAACTCGTCGGCGCCACTAGCGCCGTGGTGATGGCCTACATCCTCCCTCCGCTATGCTACGTCCGTCTCGCCACC
GCGACCGGTTGGCGCACTTGCGTCGCCTACCTCGTCGTCGTCTTTGGCGTCGCCGTCATGGCTATTAGTGTTTTG
CAGGCTGTTGCCTCGCTGGTGAGGGGGAGGGAGGCTGCTGCCTGTACGTGA
Transcript >Ophcf2|04353
ATGCGTGATGACGAGGGTGTTTTGCTAGAGAGGGTTGTTTCGGGGGGGGGTGATGATGATGAGGAGGAGGAGGAG
GAGGAGGAGGAGGAGGAGGCCATGGGGCATCTCGAGACGAGGCCGATGCTGTCCTCGGCCGCCGACGACGACGAC
GATCATCGTGACGAATCCCACGAGGAAGACGACGACGACGACGACGTTATAATCCTCGGACAATCTCAATCATCC
CACCAAGTTGCCCTCCCCTCCACCCTCCAACGCCCCAAATCCAACCTCCAATCGGCCTTCATGAACATGGCCAAC
TCCATCATCGGCGCCGGCATAATCGGCCAACCCTACGCCTTCCGCCAAGCCGGCCTCCTCACCGGCATAATCCTC
CTCGTCGCCCTCACCGTCGTCGTCGACTGGACCATCCGCCTCATCGTCATCAACAGCAAGCTCAGCGGCACCAGC
AGCTTCCAGGGCACCGTCGAGCATTGCTTCGGGAGGGCCGGCATGGTGGCCATCAGTTTGGCGCAGTGGGTTTTT
GCCTTTGGCGGCATGGTGGCTTTTGCCGTCATCGTGGGAGATACCATCCCTCACGTTCTTACCGCCGTCTGGCCG
CGTTTGCCTTTTGTTCCGGTGCTGGGCCTCTTGACGGATAGACGGGTGGCCATCATCGTCTTCGTCATGGCCGTC
AGCTATCCGCTGACATTGTACCGCGACATCGCCAAGCTGGCCAAAGCCAGCACCTTTGCCCTCATCGGCATGATA
GTCATCGTCACCACGGTCCTAATCCAAGGCATCCTCGTCCCCTCGTCAGCCCGCGGCACCTTCACAACCCCCCTC
CTAACGCTCAACACCGGCGTCTTCCAAGCCATCGGCGTGATATCCTTCGCCTTCGTCTGCCACCACAACTCCCTC
CTAATCTACGGGTCCCTCCGCACGCCAACAATAGACAACTTCTCCCGCGTAACCCACTACTCGACCACGGTCTCG
ATGCTAGCCTGCTTAACCATGGCCCTAGCCGGCTTCCTCACCTTTGGCGACAAAACAGCGGGCAACGTGCTCAAC
AACTTCCCCCCCTCGAACAACATGGTCAACCTCGCCCGCCTCTTCTTCGGCCTGAACATGCTCACGACGATGCCC
CTCGAAGCCTTGGTCTGCAGAGAGGTGATGCTGACCTACTGGTTCCCCGACTCGGCCTTCGACCTGAAACGGCAC
GTGCTCCTCAGCACCGGCCTCGTCCTCTCGGCCACGGCCCTCAGCCTGCTCACCTGCGACCTAGGCGTCGTCTTC
GAACTCGTCGGCGCCACTAGCGCCGTGGTGATGGCCTACATCCTCCCTCCGCTATGCTACGTCCGTCTCGCCACC
GCGACCGGTTGGCGCACTTGCGTCGCCTACCTCGTCGTCGTCTTTGGCGTCGCCGTCATGGCTATTAGTGTTTTG
CAGGCTGTTGCCTCGCTGGTGAGGGGGAGGGAGGCTGCTGCCTGTACGTGA
Gene >Ophcf2|04353
ATGCGTGATGACGAGGGTGTTTTGCTAGAGAGGGTTGTTTCGGGGGGGGGTGATGATGATGAGGAGGAGGAGGAG
GAGGAGGAGGAGGAGGAGGCCATGGGGCATCTCGAGACGAGGCCGATGCTGTCCTCGGCCGCCGACGACGACGAC
GATCATCGTGACGAATCCCACGAGGAAGACGACGACGACGACGACGTTATAATCCTCGGACAATCTCAATCATCC
CACCAAGTTGCCCTCCCCTCCACCCTCCAACGCCCCAAATCCAACCTCCAATCGGCCTTCATGAACATGGCCAAC
TCCATCATCGGCGCCGGCATAATCGGCCAACCCTACGCCTTCCGCCAAGCCGGCCTCCTCACCGGCATAATCCTC
CTCGTCGCCCTCACCGTCGTCGTCGACTGGACCATCCGCCTCATCGTCATCAACAGCAAGCTCAGCGGCACCAGC
AGCTTCCAGGGCACCGTCGAGCATTGCTTCGGGAGGGCCGGCATGGTGGCCATCAGTTTGGCGCAGTGGGTTTTT
GCCTTTGGCGGCATGGTGGCTTTTGCCGTCATCGTGGGAGATACCATCCCTCACGTTCTTACCGCCGTCTGGCCG
CGTTTGCCTTTTGTTCCGGTGCTGGGCCTCTTGACGGATAGACGGGTGGCCATCATCGTCTTCGTCATGGCCGTC
AGCTATCCGCTGACATTGTACCGCGACATCGCCAAGGCAAGAGTTTTCCCCCTTTCCCCCCCCCCGGGCACTACC
AACAATACATGTGCCCTGTATCGATGTAAGAGGGACGGGATCTCAACAACGATAGACTAACAAAAGAAAGCAGCT
GGCCAAAGCCAGCACCTTTGCCCTCATCGGCATGATAGTCATCGTCACCACGGTCCTAATCCAAGGCATCCTCGT
CCCCTCGTCAGCCCGCGGCACCTTCACAACCCCCCTCCTAACGCTCAACACCGGCGTCTTCCAAGCCATCGGCGT
GATATCCTTCGGTAAAACGCCCCCATATAACCTCTTCTCCCCCCCCCCCCCAAGCAACTAACAAGCTAGCCAGCC
TTCGTCTGCCACCACAACTCCCTCCTAATCTACGGGTCCCTCCGCACGCCAACAATAGACAACTTCTCCCGCGTA
ACCCACTACTCGACCACGGTCTCGATGCTAGCCTGCTTAACCATGGCCCTAGCCGGCTTCCTCACCTTTGGCGAC
AAAACAGCGGGCAACGTGCTCAACAACTTCCCCCCCTCGAACAACATGGTCAACCTCGCCCGCCTCTTCTTCGGC
CTGAACATGCTCACGACGATGCCCCTCGAAGCCTTGGTCTGCAGAGAGGTGATGCTGACCTACTGGTTCCCCGAC
TCGGCCTTCGACCTGAAACGGCACGTGCTCCTCAGCACCGGCCTCGTCCTCTCGGCCACGGCCCTCAGCCTGCTC
ACCTGCGACCTAGGCGTCGTCTTCGAACTCGTCGGCGCCACTAGCGCCGTGGTGATGGCCTACATCCTCCCTCCG
CTATGCTACGTCCGTCTCGCCACCGCGACCGGTTGGCGCACTTGCGTCGCCTACCTCGTCGTCGTCTTTGGCGTC
GCCGTCATGGCTATTAGTGTTTTGCAGGCTGTTGCCTCGCTGGTGAGGGGGAGGGAGGCTGCTGCCTGTACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail