Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04348
Gene name
Locationscaffold_04:2999424..3000711
Strand-
Gene length (bp)1287
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14388 DUF4419 Domain of unknown function (DUF4419) 1.9E-95 94 393

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1724 0.079 0.8956 0.091 0.0921 0.0563 0.4007 0.4144 0.2698 0.0022

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999763

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup87
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2106
Ophiocordyceps australis 1348a (Ghana) OphauG2|2432
Ophiocordyceps australis 1348a (Ghana) OphauG2|3791
Ophiocordyceps australis 1348a (Ghana) OphauG2|7785
Ophiocordyceps australis map64 (Brazil) OphauB2|538
Ophiocordyceps australis map64 (Brazil) OphauB2|7106
Ophiocordyceps australis map64 (Brazil) OphauB2|8110
Ophiocordyceps camponoti-floridani Ophcf2|04348 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06291
Ophiocordyceps camponoti-rufipedis Ophun1|2615
Ophiocordyceps camponoti-rufipedis Ophun1|3024
Ophiocordyceps kimflemingae Ophio5|6311
Ophiocordyceps kimflemingae Ophio5|7302
Ophiocordyceps subramaniannii Hirsu2|3102
Ophiocordyceps subramaniannii Hirsu2|9218

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04348
MRHALLMALSGFVVLTAAQFTHDLTIPLDKTVKPLPLKQDDLATSAQDLLSKSCPEEMEGYPKHGPPKLVTATSY
YKVHNAFFVDGEIFSSSSSFVRGVVEAWGQHQHLVLRPDEIWFEILVQLNFYMYANASAMRHLFVDHEGKQEMSV
RFLYAEDWAETLISSFTSAIQKRVKTDWLASWIKPGFSTSTSDDDLTAAVLMMGLTQHYFEYSFSLICGLPSVTL
LGNKTDWVALQEKVERLKWFGGEAEEYADVLKPILQGFVDTWNNPEAKTTKDFWSKIVDGRQKSTCVTRGYVTGW
ITGFYFWNREGKALTSKSARKSSRFGVKLGEVRYPARDVTKLPISYAKVPLYLEDYPKTSQTTDVYLLAGNIGVR
RTVSEGWVTAKPMSGWFIYGPVDYEHAVTKNPGSYGELLLLKDEFRQCDAPGL*
Coding >Ophcf2|04348
ATGCGTCACGCCCTTCTCATGGCCCTCTCGGGCTTCGTCGTCCTCACAGCAGCTCAGTTCACTCACGACCTCACG
ATCCCCCTGGACAAGACGGTCAAACCCCTCCCGCTCAAACAAGACGACCTCGCCACATCGGCTCAAGACCTCTTA
TCAAAGAGCTGTCCAGAAGAGATGGAGGGATACCCCAAACACGGACCCCCTAAGCTCGTCACAGCAACGTCGTAC
TACAAGGTCCACAACGCCTTCTTCGTTGACGGGGAGATCTTCTCCTCGTCTTCGAGTTTCGTGCGAGGCGTCGTC
GAAGCTTGGGGTCAGCATCAGCATTTGGTACTTCGGCCGGACGAGATCTGGTTCGAGATCCTGGTCCAGCTCAAC
TTTTACATGTACGCCAATGCCAGCGCAATGCGTCATCTCTTCGTCGACCACGAGGGGAAGCAGGAGATGAGTGTT
CGGTTCCTATATGCCGAGGACTGGGCCGAAACACTCATCTCTTCCTTCACCTCTGCTATTCAAAAGCGCGTCAAG
ACGGACTGGCTTGCTTCATGGATCAAGCCTGGATTCAGCACGTCGACGTCTGACGATGATCTCACTGCCGCCGTA
CTCATGATGGGGCTGACGCAGCACTACTTTGAGTATTCCTTCAGTCTCATCTGCGGCCTCCCGTCTGTGACGCTG
CTCGGAAACAAGACGGACTGGGTTGCTTTGCAGGAGAAGGTGGAACGTCTCAAATGGTTTGGTGGAGAAGCTGAA
GAGTACGCCGACGTTCTGAAGCCCATCCTTCAAGGCTTCGTCGATACGTGGAACAATCCCGAGGCCAAGACCACC
AAGGATTTCTGGTCCAAGATCGTCGACGGCCGTCAGAAATCCACGTGCGTTACCCGCGGCTATGTCACCGGCTGG
ATCACGGGTTTCTACTTCTGGAACAGGGAAGGCAAGGCTCTGACCTCGAAGAGCGCTCGTAAGTCGTCAAGATTC
GGCGTCAAGCTGGGCGAAGTCAGATATCCGGCCCGGGACGTCACAAAGCTGCCCATCAGCTACGCAAAGGTGCCT
CTCTACCTGGAAGATTACCCCAAGACATCTCAGACGACGGACGTCTACCTGCTGGCTGGAAACATTGGTGTTCGG
AGGACGGTGAGTGAGGGATGGGTTACTGCTAAGCCCATGAGCGGTTGGTTCATATATGGGCCTGTCGATTATGAG
CATGCGGTTACGAAGAATCCTGGGAGTTATGGGGAGCTTTTGTTGTTGAAGGATGAATTCCGTCAGTGTGACGCA
CCTGGATTATGA
Transcript >Ophcf2|04348
ATGCGTCACGCCCTTCTCATGGCCCTCTCGGGCTTCGTCGTCCTCACAGCAGCTCAGTTCACTCACGACCTCACG
ATCCCCCTGGACAAGACGGTCAAACCCCTCCCGCTCAAACAAGACGACCTCGCCACATCGGCTCAAGACCTCTTA
TCAAAGAGCTGTCCAGAAGAGATGGAGGGATACCCCAAACACGGACCCCCTAAGCTCGTCACAGCAACGTCGTAC
TACAAGGTCCACAACGCCTTCTTCGTTGACGGGGAGATCTTCTCCTCGTCTTCGAGTTTCGTGCGAGGCGTCGTC
GAAGCTTGGGGTCAGCATCAGCATTTGGTACTTCGGCCGGACGAGATCTGGTTCGAGATCCTGGTCCAGCTCAAC
TTTTACATGTACGCCAATGCCAGCGCAATGCGTCATCTCTTCGTCGACCACGAGGGGAAGCAGGAGATGAGTGTT
CGGTTCCTATATGCCGAGGACTGGGCCGAAACACTCATCTCTTCCTTCACCTCTGCTATTCAAAAGCGCGTCAAG
ACGGACTGGCTTGCTTCATGGATCAAGCCTGGATTCAGCACGTCGACGTCTGACGATGATCTCACTGCCGCCGTA
CTCATGATGGGGCTGACGCAGCACTACTTTGAGTATTCCTTCAGTCTCATCTGCGGCCTCCCGTCTGTGACGCTG
CTCGGAAACAAGACGGACTGGGTTGCTTTGCAGGAGAAGGTGGAACGTCTCAAATGGTTTGGTGGAGAAGCTGAA
GAGTACGCCGACGTTCTGAAGCCCATCCTTCAAGGCTTCGTCGATACGTGGAACAATCCCGAGGCCAAGACCACC
AAGGATTTCTGGTCCAAGATCGTCGACGGCCGTCAGAAATCCACGTGCGTTACCCGCGGCTATGTCACCGGCTGG
ATCACGGGTTTCTACTTCTGGAACAGGGAAGGCAAGGCTCTGACCTCGAAGAGCGCTCGTAAGTCGTCAAGATTC
GGCGTCAAGCTGGGCGAAGTCAGATATCCGGCCCGGGACGTCACAAAGCTGCCCATCAGCTACGCAAAGGTGCCT
CTCTACCTGGAAGATTACCCCAAGACATCTCAGACGACGGACGTCTACCTGCTGGCTGGAAACATTGGTGTTCGG
AGGACGGTGAGTGAGGGATGGGTTACTGCTAAGCCCATGAGCGGTTGGTTCATATATGGGCCTGTCGATTATGAG
CATGCGGTTACGAAGAATCCTGGGAGTTATGGGGAGCTTTTGTTGTTGAAGGATGAATTCCGTCAGTGTGACGCA
CCTGGATTATGA
Gene >Ophcf2|04348
ATGCGTCACGCCCTTCTCATGGCCCTCTCGGGCTTCGTCGTCCTCACAGCAGCTCAGTTCACTCACGACCTCACG
ATCCCCCTGGACAAGACGGTCAAACCCCTCCCGCTCAAACAAGACGACCTCGCCACATCGGCTCAAGACCTCTTA
TCAAAGAGCTGTCCAGAAGAGATGGAGGGATACCCCAAACACGGACCCCCTAAGCTCGTCACAGCAACGTCGTAC
TACAAGGTCCACAACGCCTTCTTCGTTGACGGGGAGATCTTCTCCTCGTCTTCGAGTTTCGTGCGAGGCGTCGTC
GAAGCTTGGGGTCAGCATCAGCATTTGGTACTTCGGCCGGACGAGATCTGGTTCGAGATCCTGGTCCAGCTCAAC
TTTTACATGTACGCCAATGCCAGCGCAATGCGTCATCTCTTCGTCGACCACGAGGGGAAGCAGGAGATGAGTGTT
CGGTTCCTATATGCCGAGGACTGGGCCGAAACACTCATCTCTTCCTTCACCTCTGCTATTCAAAAGCGCGTCAAG
ACGGACTGGCTTGCTTCATGGATCAAGCCTGGATTCAGCACGTCGACGTCTGACGATGATCTCACTGCCGCCGTA
CTCATGATGGGGCTGACGCAGCACTACTTTGAGTATTCCTTCAGTCTCATCTGCGGCCTCCCGTCTGTGACGCTG
CTCGGAAACAAGACGGACTGGGTTGCTTTGCAGGAGAAGGTGGAACGTCTCAAATGGTTTGGTGGAGAAGCTGAA
GAGTACGCCGACGTTCTGAAGCCCATCCTTCAAGGCTTCGTCGATACGTGGAACAATCCCGAGGCCAAGACCACC
AAGGATTTCTGGTCCAAGATCGTCGACGGCCGTCAGAAATCCACGTGCGTTACCCGCGGCTATGTCACCGGCTGG
ATCACGGGTTTCTACTTCTGGAACAGGGAAGGCAAGGCTCTGACCTCGAAGAGCGCTCGTAAGTCGTCAAGATTC
GGCGTCAAGCTGGGCGAAGTCAGATATCCGGCCCGGGACGTCACAAAGCTGCCCATCAGCTACGCAAAGGTGCCT
CTCTACCTGGAAGATTACCCCAAGACATCTCAGACGACGGACGTCTACCTGCTGGCTGGAAACATTGGTGTTCGG
AGGACGGTGAGTGAGGGATGGGTTACTGCTAAGCCCATGAGCGGTTGGTTCATATATGGGCCTGTCGATTATGAG
CATGCGGTTACGAAGAATCCTGGGAGTTATGGGGAGCTTTTGTTGTTGAAGGATGAATTCCGTCAGTGTGACGCA
CCTGGATTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail