Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04346
Gene name
Locationscaffold_04:2994982..2996765
Strand+
Gene length (bp)1783
Transcript length (bp)1590
Coding sequence length (bp)1590
Protein length (aa) 530

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10375 GRAB GRAB domain 7.2E-24 394 441

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7053 0.2467 0.088 0.1225 0.1439 0.0134 0.1341 0.0858 0.5035 0.0028

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1623
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4727
Ophiocordyceps australis map64 (Brazil) OphauB2|6279
Ophiocordyceps camponoti-floridani Ophcf2|04346 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1523
Ophiocordyceps kimflemingae Ophio5|6313
Ophiocordyceps subramaniannii Hirsu2|1293

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04346
MASTPGSKPATAPQSPTKKKASKKKKNANQKKEAVPTANGETQHENEGQDDSESLGEADKDPGNGHAPGGRIVPT
VDEGTDPTAKLDAMGKEREALRAEVAQLRRQLESIQESHEQDVSQLRSDLEESTTAKEKAEEQYQNLLGRVEKIK
ESLGDRLRRDKAELEEARERIEELEAQNEELQGSARSSGEDADKLREELQAATRELTTLRSRNNLSAHNWLREKE
ELSRTVQNLKEEMETTSTAMGEWEVLAMEERSIKDSLVDKVSELEEQMLVLKGGYESASAERDSQTTLIENLQNA
LREIQEARKKELRDMVETTEAQLRSQKQLLQEALTRRDEAEKAKEDLSKELARTAPFEKEVKEKNLLIGKLRHEA
IVLNDHLTKALRFLKRMKPEDNVDRQVVTNHFLHFLTLDRGDAKRFQVLQVIAGYLNWTDEQREQAGLARPGASS
GSLRLPPSPFHRTPSSPWLGPDMFSEPPSARDKESLAELWAGFLERSAREGAGEAPASSRKDSLGSAATGTGHSE
SGAS*
Coding >Ophcf2|04346
ATGGCGTCGACGCCCGGCTCGAAACCGGCCACGGCGCCTCAGTCGCCAACCAAGAAGAAAGCCAGCAAGAAGAAG
AAGAACGCGAATCAGAAAAAGGAGGCCGTTCCCACGGCCAACGGCGAGACGCAGCACGAGAACGAAGGACAAGAC
GATTCTGAATCGCTGGGAGAAGCCGACAAAGACCCGGGCAACGGCCATGCACCAGGAGGGCGCATCGTGCCGACC
GTCGACGAGGGGACGGATCCCACTGCCAAGCTCGATGCCATGGGCAAGGAGCGCGAGGCTCTCAGAGCCGAGGTG
GCTCAGCTGCGTAGACAGCTCGAAAGTATCCAGGAATCTCACGAACAGGATGTGTCGCAGCTACGGTCAGATTTA
GAGGAGAGCACGACGGCGAAAGAGAAGGCTGAAGAGCAGTATCAAAATCTACTAGGTCGTGTCGAGAAGATCAAA
GAGTCCTTGGGCGACAGGCTCAGGAGGGACAAGGCAGAGCTGGAGGAGGCGCGAGAGCGCATCGAGGAGCTTGAG
GCGCAAAACGAAGAACTCCAGGGCTCGGCCCGGTCATCCGGCGAGGATGCGGACAAGCTACGAGAGGAGTTGCAG
GCGGCGACGCGGGAATTGACGACTCTCCGCAGTCGCAACAATCTCTCGGCGCACAATTGGCTAAGAGAAAAGGAG
GAGCTCAGCAGGACGGTACAAAATCTCAAGGAAGAGATGGAAACAACGTCGACGGCCATGGGCGAGTGGGAGGTG
CTCGCTATGGAGGAGCGGTCTATCAAAGACAGCCTGGTAGACAAGGTATCGGAGCTCGAGGAGCAGATGCTCGTG
CTGAAGGGGGGCTACGAGAGCGCTTCTGCAGAACGCGACAGCCAGACGACTCTCATCGAGAACCTACAAAACGCG
CTGCGGGAAATCCAAGAGGCCCGCAAGAAGGAGCTGCGAGACATGGTCGAGACGACCGAGGCCCAGCTTCGCAGC
CAAAAACAGCTGCTGCAAGAGGCTTTGACACGACGAGACGAGGCTGAGAAGGCCAAGGAGGATCTGTCCAAGGAG
CTGGCCCGAACGGCGCCGTTCGAGAAGGAGGTCAAGGAGAAGAACCTGCTGATCGGCAAGCTGCGGCACGAGGCC
ATCGTGCTCAACGATCACCTGACAAAGGCGCTTCGCTTCCTGAAGAGGATGAAGCCGGAAGATAACGTCGACAGA
CAAGTGGTGACGAACCACTTCCTCCACTTCCTGACTCTGGACCGAGGCGACGCCAAGCGCTTCCAGGTCCTTCAG
GTCATAGCCGGTTACCTGAACTGGACGGACGAACAACGAGAGCAAGCCGGCCTGGCGCGGCCGGGGGCCTCGAGC
GGCAGCCTCCGTCTTCCACCGTCGCCATTCCACCGCACGCCCAGCTCGCCGTGGCTGGGACCGGACATGTTCTCA
GAGCCGCCGTCCGCCCGGGACAAGGAGTCTCTCGCCGAGCTCTGGGCCGGCTTCCTGGAGCGGAGCGCCAGGGAG
GGCGCCGGTGAGGCTCCGGCGTCTTCGCGGAAGGACAGCTTGGGGAGCGCGGCTACGGGGACGGGCCATTCCGAG
TCGGGAGCCTCGTGA
Transcript >Ophcf2|04346
ATGGCGTCGACGCCCGGCTCGAAACCGGCCACGGCGCCTCAGTCGCCAACCAAGAAGAAAGCCAGCAAGAAGAAG
AAGAACGCGAATCAGAAAAAGGAGGCCGTTCCCACGGCCAACGGCGAGACGCAGCACGAGAACGAAGGACAAGAC
GATTCTGAATCGCTGGGAGAAGCCGACAAAGACCCGGGCAACGGCCATGCACCAGGAGGGCGCATCGTGCCGACC
GTCGACGAGGGGACGGATCCCACTGCCAAGCTCGATGCCATGGGCAAGGAGCGCGAGGCTCTCAGAGCCGAGGTG
GCTCAGCTGCGTAGACAGCTCGAAAGTATCCAGGAATCTCACGAACAGGATGTGTCGCAGCTACGGTCAGATTTA
GAGGAGAGCACGACGGCGAAAGAGAAGGCTGAAGAGCAGTATCAAAATCTACTAGGTCGTGTCGAGAAGATCAAA
GAGTCCTTGGGCGACAGGCTCAGGAGGGACAAGGCAGAGCTGGAGGAGGCGCGAGAGCGCATCGAGGAGCTTGAG
GCGCAAAACGAAGAACTCCAGGGCTCGGCCCGGTCATCCGGCGAGGATGCGGACAAGCTACGAGAGGAGTTGCAG
GCGGCGACGCGGGAATTGACGACTCTCCGCAGTCGCAACAATCTCTCGGCGCACAATTGGCTAAGAGAAAAGGAG
GAGCTCAGCAGGACGGTACAAAATCTCAAGGAAGAGATGGAAACAACGTCGACGGCCATGGGCGAGTGGGAGGTG
CTCGCTATGGAGGAGCGGTCTATCAAAGACAGCCTGGTAGACAAGGTATCGGAGCTCGAGGAGCAGATGCTCGTG
CTGAAGGGGGGCTACGAGAGCGCTTCTGCAGAACGCGACAGCCAGACGACTCTCATCGAGAACCTACAAAACGCG
CTGCGGGAAATCCAAGAGGCCCGCAAGAAGGAGCTGCGAGACATGGTCGAGACGACCGAGGCCCAGCTTCGCAGC
CAAAAACAGCTGCTGCAAGAGGCTTTGACACGACGAGACGAGGCTGAGAAGGCCAAGGAGGATCTGTCCAAGGAG
CTGGCCCGAACGGCGCCGTTCGAGAAGGAGGTCAAGGAGAAGAACCTGCTGATCGGCAAGCTGCGGCACGAGGCC
ATCGTGCTCAACGATCACCTGACAAAGGCGCTTCGCTTCCTGAAGAGGATGAAGCCGGAAGATAACGTCGACAGA
CAAGTGGTGACGAACCACTTCCTCCACTTCCTGACTCTGGACCGAGGCGACGCCAAGCGCTTCCAGGTCCTTCAG
GTCATAGCCGGTTACCTGAACTGGACGGACGAACAACGAGAGCAAGCCGGCCTGGCGCGGCCGGGGGCCTCGAGC
GGCAGCCTCCGTCTTCCACCGTCGCCATTCCACCGCACGCCCAGCTCGCCGTGGCTGGGACCGGACATGTTCTCA
GAGCCGCCGTCCGCCCGGGACAAGGAGTCTCTCGCCGAGCTCTGGGCCGGCTTCCTGGAGCGGAGCGCCAGGGAG
GGCGCCGGTGAGGCTCCGGCGTCTTCGCGGAAGGACAGCTTGGGGAGCGCGGCTACGGGGACGGGCCATTCCGAG
TCGGGAGCCTCGTGA
Gene >Ophcf2|04346
ATGGCGTCGACGCCCGGCTCGAAACCGGCCACGGCGCCTCAGTCGCGTAGGTAGTCCTCTGCCTGTTCATTGGAA
AGAAATACCGTGTCTTGACGCCGCTGGAGCTGCAGCAACCAAGAAGAAAGCCAGCAAGAAGAAGAAGAACGCGAA
TCAGAAAAAGGAGGCCGTTCCCACGGCCAACGGCGAGACGCAGCACGAGAACGAAGGACAAGACGATTCTGAATC
GCTGGGAGAAGCCGTGAGTGGCAGGAAAAAGGCCTTCAGTGTCGCTAAAGAACGCCGTTGACAGCCTATCTCCGC
AGGACAAAGACCCGGGCAACGGCCATGCACCAGGAGGGCGCATCGTGCCGACCGTCGACGAGGGGACGGATCCCA
CTGCCAAGCTCGATGCCATGGGCAAGGAGCGCGAGGCTCTCAGAGCCGAGGTGGCTCAGCTGCGTAGACAGCTCG
AAAGTATCCAGGAATCTCACGAACAGGATGTGTCGCAGCTACGGTCAGATTTAGAGGAGAGCACGACGGCGAAAG
AGAAGGCTGAAGAGCAGTATCAAAATCTACTAGGTCGTGTCGAGAAGATCAAAGAGTCCTTGGGCGACAGGCTCA
GGAGGGACAAGGCAGAGCTGGAGGAGGCGCGAGAGCGCATCGAGGAGCTTGAGGCGCAAAACGAAGAACTCCAGG
GCTCGGCCCGGTCATCCGGCGAGGATGCGGACAAGCTACGAGAGGAGTTGCAGGCGGCGACGCGGGAATTGACGA
CTCTCCGCAGTCGCAACAATCTCTCGGCGCACAATTGGCTAAGAGAAAAGGAGGAGCTCAGCAGGACGGTACAAA
ATCTCAAGGAAGAGATGGAAACAACGTCGACGGCCATGGGCGAGTGGGAGGTGCTCGCTATGGAGGAGCGGTCTA
TCAAAGACAGCCTGGTAGACAAGGTATCGGAGCTCGAGGAGCAGATGCTCGTGCTGAAGGGGGGCTACGAGAGCG
CTTCTGCAGAACGCGACAGCCAGACGACTCTCATCGAGAACCTACAAAACGCGCTGCGGGAAATCCAAGAGGCCC
GCAAGAAGGAGCTGCGAGACATGGTCGAGACGACCGAGGCCCAGCTTCGCAGCCAAAAACAGCTGCTGCAAGAGG
CTTTGACACGACGAGACGAGGCTGAGAAGGCCAAGGAGGATCTGTCCAAGGAGCTGGCCCGAACGGCGCCGTTCG
AGAAGGAGGTCAAGGAGAAGAACCTGCTGATCGGCAAGCTGCGGCACGAGGCCATCGTGCTCAACGATCACCTGA
CAAAGGCGCTTCGCTTCCTGAAGAGGATGAAGCCGGAAGATAACGTCGACAGGTGAGTCCGACCCGCTCTTGGGA
GGCGGCGAGATGACGTAGGGGGGATACTGAGAAGCGAGACAGACAAGTGGTGACGAACCACTTCCTCCACTTCCT
GACTCTGGACCGAGGCGACGCCAAGCGCTTCCAGGTCCTTCAGGTCATAGCCGGTTACCTGAACTGGACGGACGA
ACAACGAGAGCAAGCCGGCCTGGCGCGGCCGGGGGCCTCGAGCGGCAGCCTCCGTCTTCCACCGTCGCCATTCCA
CCGCACGCCCAGCTCGCCGTGGCTGGGACCGGACATGTTCTCAGAGCCGCCGTCCGCCCGGGACAAGGAGTCTCT
CGCCGAGCTCTGGGCCGGCTTCCTGGAGCGGAGCGCCAGGGAGGGCGCCGGTGAGGCTCCGGCGTCTTCGCGGAA
GGACAGCTTGGGGAGCGCGGCTACGGGGACGGGCCATTCCGAGTCGGGAGCCTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail