Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04345
Gene name
Locationscaffold_04:2993239..2994440
Strand+
Gene length (bp)1201
Transcript length (bp)1104
Coding sequence length (bp)1104
Protein length (aa) 368

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.8E-14 157 226

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1845 0.8757 0.0611 0.0102 0.037 0.0321 0.0512 0.0051 0.0203 0.0015

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4897
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2185
Ophiocordyceps australis map64 (Brazil) OphauB2|6278
Ophiocordyceps camponoti-floridani Ophcf2|04345 (this protein)
Ophiocordyceps kimflemingae Ophio5|6314
Ophiocordyceps subramaniannii Hirsu2|1294

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04345
MAPGTKKAKPTLEPRRSLRTATKAAVEASSKPKRKAVDESSPISLKKQKSVKPTPAREKPAVKESKAVKSDKPSK
PTEEPPAGAEDTTIRVAESSSDSEDEGNNGVLLLAEEMDSGDEEGEPSDGALFQPGQAVGKIPSISKDVVKSAKP
FGKRGVVYIGRIPHGFYEYEMRQYLSQFGPVTRLRLSRNKRTGASKHFAFVEFEDESTAEIVAKTMDNYLLFGHI
LKVKMVPESQIHADLWKGANRRFKKVPWEILDGRKLAEPRSASKWEIKLQQERQARTQRAGKLKALGYEFETPEL
KAVPIVAPTEIKAIEAAPQNYVEDEVVVKALEEATGEQAEEVAENTTISQARKASKKSSKSSKAKSK*
Coding >Ophcf2|04345
ATGGCTCCCGGAACGAAGAAAGCAAAGCCCACGTTAGAGCCTCGGAGAAGCCTGAGAACAGCGACCAAGGCCGCA
GTCGAGGCCTCGTCCAAGCCCAAGCGCAAAGCTGTCGATGAATCCTCCCCTATCTCTCTCAAGAAGCAAAAGTCG
GTAAAGCCGACGCCCGCACGGGAGAAACCGGCGGTAAAAGAGTCCAAAGCCGTCAAGTCCGATAAACCCAGCAAG
CCCACCGAAGAGCCTCCAGCGGGCGCTGAGGATACAACAATTAGGGTCGCGGAGAGCTCTTCAGACTCGGAAGAT
GAGGGTAACAATGGCGTGCTACTTTTGGCTGAGGAGATGGACTCAGGCGACGAGGAAGGCGAGCCGAGCGATGGC
GCGCTGTTTCAGCCCGGGCAAGCGGTGGGCAAGATACCGAGTATCTCCAAAGACGTGGTGAAGTCGGCCAAGCCG
TTCGGAAAGCGCGGCGTCGTCTACATCGGCCGCATTCCTCATGGCTTCTACGAGTATGAGATGAGACAGTATTTG
TCACAATTCGGACCGGTTACTCGCCTTCGACTCTCACGAAACAAGAGAACGGGGGCAAGCAAGCACTTTGCCTTT
GTCGAATTCGAGGACGAGAGCACAGCCGAGATTGTTGCCAAGACCATGGACAACTACCTACTGTTTGGACACATA
CTCAAGGTCAAGATGGTGCCCGAGAGCCAGATCCACGCCGACTTGTGGAAAGGCGCGAACCGAAGGTTCAAAAAG
GTTCCATGGGAAATATTGGATGGTCGCAAACTGGCTGAGCCGCGATCTGCTTCCAAATGGGAGATCAAATTGCAA
CAAGAGCGACAGGCTCGGACGCAGAGGGCCGGAAAGCTCAAAGCTCTTGGCTACGAATTCGAGACACCTGAACTG
AAAGCGGTTCCAATCGTCGCTCCCACTGAAATCAAGGCCATTGAGGCGGCTCCTCAAAATTATGTCGAGGACGAG
GTTGTGGTGAAGGCATTGGAGGAAGCGACAGGCGAGCAGGCTGAAGAGGTGGCTGAAAATACGACGATTTCACAG
GCCCGGAAGGCGTCGAAGAAGTCATCAAAGTCCAGCAAGGCGAAGAGCAAGTAG
Transcript >Ophcf2|04345
ATGGCTCCCGGAACGAAGAAAGCAAAGCCCACGTTAGAGCCTCGGAGAAGCCTGAGAACAGCGACCAAGGCCGCA
GTCGAGGCCTCGTCCAAGCCCAAGCGCAAAGCTGTCGATGAATCCTCCCCTATCTCTCTCAAGAAGCAAAAGTCG
GTAAAGCCGACGCCCGCACGGGAGAAACCGGCGGTAAAAGAGTCCAAAGCCGTCAAGTCCGATAAACCCAGCAAG
CCCACCGAAGAGCCTCCAGCGGGCGCTGAGGATACAACAATTAGGGTCGCGGAGAGCTCTTCAGACTCGGAAGAT
GAGGGTAACAATGGCGTGCTACTTTTGGCTGAGGAGATGGACTCAGGCGACGAGGAAGGCGAGCCGAGCGATGGC
GCGCTGTTTCAGCCCGGGCAAGCGGTGGGCAAGATACCGAGTATCTCCAAAGACGTGGTGAAGTCGGCCAAGCCG
TTCGGAAAGCGCGGCGTCGTCTACATCGGCCGCATTCCTCATGGCTTCTACGAGTATGAGATGAGACAGTATTTG
TCACAATTCGGACCGGTTACTCGCCTTCGACTCTCACGAAACAAGAGAACGGGGGCAAGCAAGCACTTTGCCTTT
GTCGAATTCGAGGACGAGAGCACAGCCGAGATTGTTGCCAAGACCATGGACAACTACCTACTGTTTGGACACATA
CTCAAGGTCAAGATGGTGCCCGAGAGCCAGATCCACGCCGACTTGTGGAAAGGCGCGAACCGAAGGTTCAAAAAG
GTTCCATGGGAAATATTGGATGGTCGCAAACTGGCTGAGCCGCGATCTGCTTCCAAATGGGAGATCAAATTGCAA
CAAGAGCGACAGGCTCGGACGCAGAGGGCCGGAAAGCTCAAAGCTCTTGGCTACGAATTCGAGACACCTGAACTG
AAAGCGGTTCCAATCGTCGCTCCCACTGAAATCAAGGCCATTGAGGCGGCTCCTCAAAATTATGTCGAGGACGAG
GTTGTGGTGAAGGCATTGGAGGAAGCGACAGGCGAGCAGGCTGAAGAGGTGGCTGAAAATACGACGATTTCACAG
GCCCGGAAGGCGTCGAAGAAGTCATCAAAGTCCAGCAAGGCGAAGAGCAAGTAG
Gene >Ophcf2|04345
ATGGCTCCCGGAACGAAGAAAGCAAAGCGTAAGCGCCCAAAACTCTTTCATTGGACCAGGTAGTGACCTTTTGCA
GCCACGTTAGAGCCTCGGAGAAGCCTGAGAACAGCGACCAAGGCCGCAGTCGAGGCCTCGTCCAAGCCCAAGCGC
AAAGGTGTGTTGCCCGCTACGGTCATCGTTGTCGCCATGCTCACATGATCCAGCTGTCGATGAATCCTCCCCTAT
CTCTCTCAAGAAGCAAAAGTCGGTAAAGCCGACGCCCGCACGGGAGAAACCGGCGGTAAAAGAGTCCAAAGCCGT
CAAGTCCGATAAACCCAGCAAGCCCACCGAAGAGCCTCCAGCGGGCGCTGAGGATACAACAATTAGGGTCGCGGA
GAGCTCTTCAGACTCGGAAGATGAGGGTAACAATGGCGTGCTACTTTTGGCTGAGGAGATGGACTCAGGCGACGA
GGAAGGCGAGCCGAGCGATGGCGCGCTGTTTCAGCCCGGGCAAGCGGTGGGCAAGATACCGAGTATCTCCAAAGA
CGTGGTGAAGTCGGCCAAGCCGTTCGGAAAGCGCGGCGTCGTCTACATCGGCCGCATTCCTCATGGCTTCTACGA
GTATGAGATGAGACAGTATTTGTCACAATTCGGACCGGTTACTCGCCTTCGACTCTCACGAAACAAGAGAACGGG
GGCAAGCAAGCACTTTGCCTTTGTCGAATTCGAGGACGAGAGCACAGCCGAGATTGTTGCCAAGACCATGGACAA
CTACCTACTGTTTGGACACATACTCAAGGTCAAGATGGTGCCCGAGAGCCAGATCCACGCCGACTTGTGGAAAGG
CGCGAACCGAAGGTTCAAAAAGGTTCCATGGGAAATATTGGATGGTCGCAAACTGGCTGAGCCGCGATCTGCTTC
CAAATGGGAGATCAAATTGCAACAAGAGCGACAGGCTCGGACGCAGAGGGCCGGAAAGCTCAAAGCTCTTGGCTA
CGAATTCGAGACACCTGAACTGAAAGCGGTTCCAATCGTCGCTCCCACTGAAATCAAGGCCATTGAGGCGGCTCC
TCAAAATTATGTCGAGGACGAGGTTGTGGTGAAGGCATTGGAGGAAGCGACAGGCGAGCAGGCTGAAGAGGTGGC
TGAAAATACGACGATTTCACAGGCCCGGAAGGCGTCGAAGAAGTCATCAAAGTCCAGCAAGGCGAAGAGCAAGTA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail