Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04334
Gene name
Locationscaffold_04:2960491..2965999
Strand+
Gene length (bp)5508
Transcript length (bp)4350
Coding sequence length (bp)4350
Protein length (aa) 1450

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 6.1E-15 482 582
PF00168 C2 C2 domain 3.9E-08 668 798

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

Domain # Start End Length
1 187 209 22
2 365 387 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04334
MDVTEHVLPSGQHYSGRNRIPNIQQFAEQLDSEKRQRDAEIDAELRQDADAREHHAANKDKRDHTRTVRDPVTGK
DVAISDAHADYKEAVDEPQLSVPNENLGRPTTVRVSSQQSGEEYRRTQDITAPPAPVQEGSTSDVPISSEKTSIL
FYKTPSVSYEPMFVALERKATVLCFGISIAIVFIGKLFGGRLLGLIPLAICVSSGVFLWAQDLVRQGRDVEWSSE
QQRGETATANLIPESVEWMNTAIGLVWSLINPEMFASAADTLEDVMVASVPGVIENVRVADISQGSNPIRILSMR
ALPDSHVQDIKQEIHRENEKNMDPNELAAVEQAGSFYNMEVSIAYHAKPSGEDITSKAKNMGMQLIFYLGIKGLF
GVPLPVWVELIGLVATARVRLQLTPDPPFLKTLTVTLMGVPKVQAGCTPMIEKGVNILNLPLISNFVNWAIRTAA
SMYVAPKSLTLDMSKMLSGDDIKKETQALGVIFIRIHKATGLSKQDHTGSRGGGSDPYITVSWSKFSKPQFCTRV
IQDDLNPVFEETCGLLVTSDLIKADEQLSMELWDSDRSSADDVVGKVQLSIQKLIQHPGKMFPQVSHLCGVKAES
SMPGQLHWEVGFFGKTKFRKALRTDGRDVTLPKELADKPELQDQRGSIDSKEEDAVVHTPPDPLWPSGILSVVVH
QIVGLELANIKGSNGKRKGREYEPARPEAGEVKEEQSRKLPSSYCTVLINDDLVYKTRIKAVSSQPIFNAGTEKF
IRDWRSCIATVAVRDSRNRQHDPIIGVVPLQLSDVLRTSSQLTRWYPLDGGIGFGRIRISILFRSVELRLPPPQL
GWDIGTFEFTSDSITTTGYAPSQSVKLKLRTGGSSATVKKNMSTREETGMRIDISGGEDGKLMRLPVRHRYRCPI
FIEFYSSSSRKPDAYAALWLLELSDGEETDFEVPVFTCSNGLRLSQNYITQDNYREIPDMKIEEVGRVRFRGRFS
PGTDSDHMKFVSDNDSRETIETWEACYAEGVRQEEVKAEVPPVVMELHDKSLTHGRDVLAQADEEAKQRWLAKDG
TDWSGAFGKDPRDLMANNAGGDGDSETRDDAAGEYDSSDSDPDLGIEEYPSATGDETENGRPSAETRGESESSSS
STHDGSGSKNPYTLYKTYTARNRDLHRKHRGLMQWRPMRNAQFAKDEAKFALRKERDDRSFIQERNNRSYTQEGD
DCPYTQERVQEGVGRLTAQIGGTKCFAISGGDYDYDCDDYDDSDSDFDVDDGKEARVGGSQKPRTAQGLASGHVL
LGDARQVAARSSRAAEAEVDGGQLRPRFPEFLCEWTGCKAELHNLETLRRHVLFVHGGSGCRCFWGKCMASVATA
DEFRSHVEEAHMVPVAWHMGDGPRNWSRYTGGDGEDGQVPDYLLDEHGVQVTPSIRDQEVEDVLTWRMNRRKLKE
LLIRRDENLPDEDSDEEGEEEEVS*
Coding >Ophcf2|04334
ATGGACGTCACGGAACATGTCCTGCCCTCGGGCCAGCACTACAGTGGCCGCAACCGCATCCCTAACATCCAGCAG
TTCGCCGAGCAGCTCGACTCGGAGAAGCGGCAGCGAGATGCCGAGATTGATGCTGAGCTTCGTCAGGATGCGGAC
GCGCGGGAGCATCATGCTGCGAATAAGGACAAGAGGGACCATACGCGCACCGTCCGCGATCCCGTTACGGGAAAG
GATGTTGCCATTAGCGATGCTCACGCTGACTACAAGGAGGCTGTCGACGAACCTCAATTATCCGTTCCCAACGAG
AATCTCGGCAGGCCGACGACAGTGAGGGTCTCGTCGCAGCAGTCGGGCGAGGAGTACCGTCGTACTCAGGACATC
ACGGCGCCGCCCGCTCCGGTCCAGGAAGGGTCTACGTCCGACGTCCCCATTAGCAGCGAGAAGACGTCGATTCTA
TTCTACAAGACGCCGTCGGTCAGCTACGAGCCCATGTTTGTGGCTCTCGAGCGCAAGGCAACGGTTCTGTGCTTT
GGCATTTCCATTGCCATCGTCTTCATCGGCAAGTTGTTTGGTGGGAGGCTCCTTGGACTCATTCCCCTGGCCATT
TGCGTCTCCTCAGGCGTCTTTCTCTGGGCTCAGGATCTCGTCCGTCAGGGCAGGGATGTTGAGTGGTCGAGCGAG
CAGCAGCGTGGTGAGACGGCTACCGCGAACCTGATTCCCGAGTCTGTCGAGTGGATGAACACGGCCATTGGGCTG
GTATGGAGCCTCATCAATCCCGAGATGTTTGCCTCTGCCGCCGACACGCTGGAGGATGTCATGGTTGCCTCGGTC
CCAGGCGTCATTGAAAACGTTCGCGTTGCCGACATTTCTCAGGGCAGCAACCCTATCAGGATCCTCAGCATGAGA
GCTCTGCCGGACTCTCACGTACAAGACATCAAGCAGGAGATTCACCGAGAAAACGAAAAGAACATGGACCCCAAT
GAACTGGCTGCCGTTGAGCAGGCTGGTTCCTTTTACAACATGGAGGTTTCCATCGCCTACCACGCCAAACCGTCT
GGCGAGGACATCACGTCCAAGGCCAAGAATATGGGCATGCAGCTCATCTTCTACCTCGGCATCAAGGGTCTCTTC
GGTGTGCCTTTGCCCGTCTGGGTCGAGCTGATAGGGCTCGTGGCGACGGCCCGCGTGCGACTGCAGCTGACGCCA
GATCCCCCCTTCCTCAAGACGCTCACCGTCACCCTCATGGGCGTGCCCAAGGTGCAGGCCGGCTGCACCCCCATG
ATAGAAAAGGGCGTCAACATCCTGAACCTGCCGCTCATCTCCAACTTTGTCAACTGGGCCATCCGTACGGCCGCG
TCCATGTACGTGGCGCCCAAGAGCTTGACGTTGGATATGAGCAAGATGCTATCGGGTGACGACATTAAGAAGGAG
ACGCAAGCCCTGGGCGTCATCTTTATCCGAATTCACAAGGCGACGGGCCTCAGCAAGCAGGACCACACGGGCAGC
CGCGGCGGTGGCTCGGATCCCTACATTACGGTCAGCTGGAGCAAGTTCTCCAAGCCTCAGTTCTGCACACGCGTC
ATCCAGGACGACCTGAACCCCGTCTTCGAGGAGACTTGCGGCCTCTTGGTCACGAGCGACCTCATCAAGGCCGAC
GAGCAGCTGTCGATGGAGCTCTGGGACAGCGATCGTTCGTCCGCCGACGATGTCGTGGGCAAGGTTCAGCTCAGC
ATCCAGAAGCTCATTCAGCACCCGGGCAAGATGTTCCCTCAGGTCTCTCACCTGTGCGGCGTCAAGGCCGAGAGC
AGCATGCCCGGTCAACTCCACTGGGAGGTGGGCTTCTTCGGCAAGACAAAGTTCCGCAAGGCGCTGAGGACCGAC
GGCCGCGACGTCACCCTGCCCAAGGAGCTGGCTGACAAGCCCGAGCTCCAGGACCAGAGGGGCAGCATCGACAGC
AAGGAGGAGGATGCCGTCGTCCACACGCCGCCCGACCCTCTGTGGCCGTCGGGCATCCTCAGCGTCGTCGTCCAC
CAGATCGTCGGCCTCGAGCTCGCCAACATCAAGGGCTCTAACGGTAAGCGCAAGGGCCGGGAGTACGAGCCGGCG
AGGCCTGAGGCGGGCGAGGTCAAGGAGGAGCAGAGTCGGAAGCTGCCGAGCTCATACTGCACGGTCCTGATCAAC
GATGATCTGGTGTACAAGACACGCATCAAGGCGGTTTCTTCGCAGCCCATCTTCAACGCCGGGACGGAAAAGTTC
ATCCGCGACTGGAGATCCTGCATCGCCACCGTTGCCGTGCGCGACTCTCGGAACAGGCAGCACGACCCCATCATC
GGCGTCGTGCCTCTGCAGCTGTCTGACGTGCTGCGGACGAGCAGCCAGTTGACGCGGTGGTATCCCCTCGACGGC
GGCATCGGCTTCGGCCGGATCCGCATCTCCATCCTCTTCCGCTCCGTCGAACTCCGACTGCCGCCGCCGCAGCTC
GGCTGGGATATCGGGACGTTTGAATTCACGTCCGACAGCATCACCACGACGGGATACGCGCCGTCTCAGAGCGTC
AAGTTGAAGCTGCGTACGGGCGGATCGTCGGCGACGGTCAAGAAGAACATGTCGACCAGGGAAGAGACGGGAATG
AGAATCGACATCAGCGGTGGGGAAGACGGGAAGCTGATGCGACTCCCCGTCCGTCACCGGTATCGATGCCCCATC
TTCATCGAGTTTTACTCGTCGAGCAGCCGCAAGCCGGACGCCTACGCTGCCCTGTGGCTGTTGGAGCTCAGCGAC
GGGGAAGAGACGGACTTTGAAGTGCCCGTCTTTACCTGTAGCAATGGCCTGCGTCTCTCTCAGAATTACATCACC
CAGGACAACTACCGGGAGATTCCCGACATGAAGATTGAGGAGGTCGGCCGCGTCCGGTTCCGCGGCCGCTTCTCA
CCCGGCACCGACTCGGACCACATGAAGTTTGTCAGCGACAACGACTCTCGAGAGACGATTGAGACGTGGGAGGCG
TGCTACGCCGAAGGTGTGCGGCAGGAAGAGGTCAAGGCGGAGGTGCCTCCGGTGGTGATGGAACTGCACGACAAG
TCGTTGACGCACGGCCGAGACGTGCTCGCCCAGGCGGACGAAGAAGCCAAGCAGCGATGGCTGGCAAAGGACGGC
ACGGACTGGAGCGGTGCCTTTGGCAAGGACCCCAGGGACCTGATGGCGAACAACGCGGGGGGAGACGGCGACAGC
GAGACGCGGGACGATGCGGCGGGAGAATACGACAGCAGCGACAGCGATCCGGATCTGGGCATCGAGGAGTACCCG
AGCGCGACGGGAGATGAGACGGAGAATGGCCGACCGTCGGCGGAAACGAGGGGAGAATCGGAGTCGTCGTCTTCG
TCTACGCACGACGGCAGCGGCAGCAAGAACCCGTACACCTTGTACAAGACGTACACGGCACGGAACCGCGACCTG
CATCGCAAGCACCGCGGGTTGATGCAGTGGCGGCCGATGCGCAACGCGCAGTTTGCCAAGGACGAGGCCAAGTTT
GCCCTGCGCAAGGAGAGAGACGACCGTTCCTTCATCCAGGAGAGGAACAACCGTTCCTATACCCAGGAGGGAGAC
GACTGTCCCTACACCCAAGAAAGAGTCCAGGAGGGAGTCGGCCGTCTCACTGCCCAAATTGGCGGCACGAAATGC
TTCGCGATCAGCGGCGGCGACTACGACTACGACTGCGACGACTACGACGACTCCGACTCCGACTTCGACGTCGAC
GACGGTAAAGAGGCCCGTGTTGGCGGATCCCAAAAGCCGAGGACGGCCCAAGGGCTGGCGAGCGGGCATGTCTTA
CTCGGAGATGCGAGGCAGGTCGCCGCCCGGTCCTCGAGGGCGGCAGAGGCCGAAGTCGACGGCGGACAACTACGG
CCGCGGTTCCCCGAATTCCTATGCGAGTGGACAGGGTGTAAGGCGGAGCTGCACAACCTCGAAACGCTGCGGAGG
CACGTCCTCTTCGTCCACGGCGGTTCGGGCTGTCGCTGCTTCTGGGGCAAATGCATGGCCTCGGTGGCGACGGCC
GACGAGTTCAGGTCGCATGTGGAGGAGGCGCATATGGTGCCGGTGGCGTGGCACATGGGTGATGGGCCGCGGAAC
TGGAGCCGATATACGGGAGGCGATGGCGAGGATGGGCAGGTTCCGGATTACCTGCTAGATGAGCATGGGGTGCAG
GTGACGCCATCGATTCGCGACCAGGAGGTCGAGGACGTGTTGACGTGGCGGATGAATCGGAGGAAGCTCAAGGAG
TTGCTGATTCGGAGGGATGAGAATCTGCCTGATGAAGACTCGGACGAGGAGGGCGAGGAGGAAGAGGTTAGTTGA
Transcript >Ophcf2|04334
ATGGACGTCACGGAACATGTCCTGCCCTCGGGCCAGCACTACAGTGGCCGCAACCGCATCCCTAACATCCAGCAG
TTCGCCGAGCAGCTCGACTCGGAGAAGCGGCAGCGAGATGCCGAGATTGATGCTGAGCTTCGTCAGGATGCGGAC
GCGCGGGAGCATCATGCTGCGAATAAGGACAAGAGGGACCATACGCGCACCGTCCGCGATCCCGTTACGGGAAAG
GATGTTGCCATTAGCGATGCTCACGCTGACTACAAGGAGGCTGTCGACGAACCTCAATTATCCGTTCCCAACGAG
AATCTCGGCAGGCCGACGACAGTGAGGGTCTCGTCGCAGCAGTCGGGCGAGGAGTACCGTCGTACTCAGGACATC
ACGGCGCCGCCCGCTCCGGTCCAGGAAGGGTCTACGTCCGACGTCCCCATTAGCAGCGAGAAGACGTCGATTCTA
TTCTACAAGACGCCGTCGGTCAGCTACGAGCCCATGTTTGTGGCTCTCGAGCGCAAGGCAACGGTTCTGTGCTTT
GGCATTTCCATTGCCATCGTCTTCATCGGCAAGTTGTTTGGTGGGAGGCTCCTTGGACTCATTCCCCTGGCCATT
TGCGTCTCCTCAGGCGTCTTTCTCTGGGCTCAGGATCTCGTCCGTCAGGGCAGGGATGTTGAGTGGTCGAGCGAG
CAGCAGCGTGGTGAGACGGCTACCGCGAACCTGATTCCCGAGTCTGTCGAGTGGATGAACACGGCCATTGGGCTG
GTATGGAGCCTCATCAATCCCGAGATGTTTGCCTCTGCCGCCGACACGCTGGAGGATGTCATGGTTGCCTCGGTC
CCAGGCGTCATTGAAAACGTTCGCGTTGCCGACATTTCTCAGGGCAGCAACCCTATCAGGATCCTCAGCATGAGA
GCTCTGCCGGACTCTCACGTACAAGACATCAAGCAGGAGATTCACCGAGAAAACGAAAAGAACATGGACCCCAAT
GAACTGGCTGCCGTTGAGCAGGCTGGTTCCTTTTACAACATGGAGGTTTCCATCGCCTACCACGCCAAACCGTCT
GGCGAGGACATCACGTCCAAGGCCAAGAATATGGGCATGCAGCTCATCTTCTACCTCGGCATCAAGGGTCTCTTC
GGTGTGCCTTTGCCCGTCTGGGTCGAGCTGATAGGGCTCGTGGCGACGGCCCGCGTGCGACTGCAGCTGACGCCA
GATCCCCCCTTCCTCAAGACGCTCACCGTCACCCTCATGGGCGTGCCCAAGGTGCAGGCCGGCTGCACCCCCATG
ATAGAAAAGGGCGTCAACATCCTGAACCTGCCGCTCATCTCCAACTTTGTCAACTGGGCCATCCGTACGGCCGCG
TCCATGTACGTGGCGCCCAAGAGCTTGACGTTGGATATGAGCAAGATGCTATCGGGTGACGACATTAAGAAGGAG
ACGCAAGCCCTGGGCGTCATCTTTATCCGAATTCACAAGGCGACGGGCCTCAGCAAGCAGGACCACACGGGCAGC
CGCGGCGGTGGCTCGGATCCCTACATTACGGTCAGCTGGAGCAAGTTCTCCAAGCCTCAGTTCTGCACACGCGTC
ATCCAGGACGACCTGAACCCCGTCTTCGAGGAGACTTGCGGCCTCTTGGTCACGAGCGACCTCATCAAGGCCGAC
GAGCAGCTGTCGATGGAGCTCTGGGACAGCGATCGTTCGTCCGCCGACGATGTCGTGGGCAAGGTTCAGCTCAGC
ATCCAGAAGCTCATTCAGCACCCGGGCAAGATGTTCCCTCAGGTCTCTCACCTGTGCGGCGTCAAGGCCGAGAGC
AGCATGCCCGGTCAACTCCACTGGGAGGTGGGCTTCTTCGGCAAGACAAAGTTCCGCAAGGCGCTGAGGACCGAC
GGCCGCGACGTCACCCTGCCCAAGGAGCTGGCTGACAAGCCCGAGCTCCAGGACCAGAGGGGCAGCATCGACAGC
AAGGAGGAGGATGCCGTCGTCCACACGCCGCCCGACCCTCTGTGGCCGTCGGGCATCCTCAGCGTCGTCGTCCAC
CAGATCGTCGGCCTCGAGCTCGCCAACATCAAGGGCTCTAACGGTAAGCGCAAGGGCCGGGAGTACGAGCCGGCG
AGGCCTGAGGCGGGCGAGGTCAAGGAGGAGCAGAGTCGGAAGCTGCCGAGCTCATACTGCACGGTCCTGATCAAC
GATGATCTGGTGTACAAGACACGCATCAAGGCGGTTTCTTCGCAGCCCATCTTCAACGCCGGGACGGAAAAGTTC
ATCCGCGACTGGAGATCCTGCATCGCCACCGTTGCCGTGCGCGACTCTCGGAACAGGCAGCACGACCCCATCATC
GGCGTCGTGCCTCTGCAGCTGTCTGACGTGCTGCGGACGAGCAGCCAGTTGACGCGGTGGTATCCCCTCGACGGC
GGCATCGGCTTCGGCCGGATCCGCATCTCCATCCTCTTCCGCTCCGTCGAACTCCGACTGCCGCCGCCGCAGCTC
GGCTGGGATATCGGGACGTTTGAATTCACGTCCGACAGCATCACCACGACGGGATACGCGCCGTCTCAGAGCGTC
AAGTTGAAGCTGCGTACGGGCGGATCGTCGGCGACGGTCAAGAAGAACATGTCGACCAGGGAAGAGACGGGAATG
AGAATCGACATCAGCGGTGGGGAAGACGGGAAGCTGATGCGACTCCCCGTCCGTCACCGGTATCGATGCCCCATC
TTCATCGAGTTTTACTCGTCGAGCAGCCGCAAGCCGGACGCCTACGCTGCCCTGTGGCTGTTGGAGCTCAGCGAC
GGGGAAGAGACGGACTTTGAAGTGCCCGTCTTTACCTGTAGCAATGGCCTGCGTCTCTCTCAGAATTACATCACC
CAGGACAACTACCGGGAGATTCCCGACATGAAGATTGAGGAGGTCGGCCGCGTCCGGTTCCGCGGCCGCTTCTCA
CCCGGCACCGACTCGGACCACATGAAGTTTGTCAGCGACAACGACTCTCGAGAGACGATTGAGACGTGGGAGGCG
TGCTACGCCGAAGGTGTGCGGCAGGAAGAGGTCAAGGCGGAGGTGCCTCCGGTGGTGATGGAACTGCACGACAAG
TCGTTGACGCACGGCCGAGACGTGCTCGCCCAGGCGGACGAAGAAGCCAAGCAGCGATGGCTGGCAAAGGACGGC
ACGGACTGGAGCGGTGCCTTTGGCAAGGACCCCAGGGACCTGATGGCGAACAACGCGGGGGGAGACGGCGACAGC
GAGACGCGGGACGATGCGGCGGGAGAATACGACAGCAGCGACAGCGATCCGGATCTGGGCATCGAGGAGTACCCG
AGCGCGACGGGAGATGAGACGGAGAATGGCCGACCGTCGGCGGAAACGAGGGGAGAATCGGAGTCGTCGTCTTCG
TCTACGCACGACGGCAGCGGCAGCAAGAACCCGTACACCTTGTACAAGACGTACACGGCACGGAACCGCGACCTG
CATCGCAAGCACCGCGGGTTGATGCAGTGGCGGCCGATGCGCAACGCGCAGTTTGCCAAGGACGAGGCCAAGTTT
GCCCTGCGCAAGGAGAGAGACGACCGTTCCTTCATCCAGGAGAGGAACAACCGTTCCTATACCCAGGAGGGAGAC
GACTGTCCCTACACCCAAGAAAGAGTCCAGGAGGGAGTCGGCCGTCTCACTGCCCAAATTGGCGGCACGAAATGC
TTCGCGATCAGCGGCGGCGACTACGACTACGACTGCGACGACTACGACGACTCCGACTCCGACTTCGACGTCGAC
GACGGTAAAGAGGCCCGTGTTGGCGGATCCCAAAAGCCGAGGACGGCCCAAGGGCTGGCGAGCGGGCATGTCTTA
CTCGGAGATGCGAGGCAGGTCGCCGCCCGGTCCTCGAGGGCGGCAGAGGCCGAAGTCGACGGCGGACAACTACGG
CCGCGGTTCCCCGAATTCCTATGCGAGTGGACAGGGTGTAAGGCGGAGCTGCACAACCTCGAAACGCTGCGGAGG
CACGTCCTCTTCGTCCACGGCGGTTCGGGCTGTCGCTGCTTCTGGGGCAAATGCATGGCCTCGGTGGCGACGGCC
GACGAGTTCAGGTCGCATGTGGAGGAGGCGCATATGGTGCCGGTGGCGTGGCACATGGGTGATGGGCCGCGGAAC
TGGAGCCGATATACGGGAGGCGATGGCGAGGATGGGCAGGTTCCGGATTACCTGCTAGATGAGCATGGGGTGCAG
GTGACGCCATCGATTCGCGACCAGGAGGTCGAGGACGTGTTGACGTGGCGGATGAATCGGAGGAAGCTCAAGGAG
TTGCTGATTCGGAGGGATGAGAATCTGCCTGATGAAGACTCGGACGAGGAGGGCGAGGAGGAAGAGGTTAGTTGA
Gene >Ophcf2|04334
ATGGACGTCACGGAACATGTCCTGCCCTCGGGCCAGCACTACAGTGGCCGCAACCGCATCCCTAACATCCAGCAG
TTCGCCGAGCAGCTCGACTCGGAGAAGCGGCAGCGAGATGCCGAGATTGATGCTGAGCTTCGTCAGGATGCGGAC
GCGCGGGAGCATCATGCTGCGAATAAGGACAAGAGGGACCATACGCGCACCGTCCGCGATCCCGTTACGGGAAAG
GATGTTGCCATTAGCGATGCTCACGCTGACTACAAGGAGGCTGTCGACGAACCTCAAGTGGGTGCTCCTTTGCCT
CTCTCGTCGTCTCGTTTGAAGCTGACGACTGACTGCCTTTAGTTATCCGTTCCCAACGAGAATCTCGGCAGGCCG
ACGACAGTGAGGGTCTCGTCGCAGCAGTCGGGCGAGGAGTACCGTCGTACTCAGGACATCACGGCGCCGCCCGCT
CCGGTCCAGGAAGGGTCTACGTCCGACGTCCCCATTAGCAGCGAGAAGACGTCGATTCTATTCTACAAGACGCCG
TCGGTCAGCTACGAGCCCATGTTTGTGGCTCTCGAGCGCAAGGCAACGGTTCTGTGCTTTGGCATTTCCATTGCC
ATCGTCTTCATCGGCAAGTTGTTTGGTGGGAGGCTCCTTGGACTCATTCCCCTGGCCATTTGCGTCTCCTCAGGC
GTCTTTCTCTGGGCTCAGGATCTCGTCCGTCAGGGCAGGGATGTTGAGTGGTCGAGCGAGCAGCAGCGTGGTGAG
ACGGCTACCGCGAACCTGATTCCCGAGTCTGTCGAGTGGATGAACACGGCCATTGGGCTGGTATGGAGCCTCATC
AATCCCGAGATGTTTGCCTCTGCCGCCGACACGTGAGTCTTGCCTTTTCTCGTGTTGGAGGATGAGGGCGCTGAC
GAGAGAGGCAGGCTGGAGGATGTCATGGTTGCCTCGGTCCCAGGCGTCATTGAAAACGTTCGCGTTGCCGACATT
TCTCAGGGCAGCAACCCTATCAGGATCCTCAGCATGAGAGCTCTGCCGGACTCTCACGTACAAGACATCAAGCAG
GAGATTCACCGAGAAAACGAAAAGAACATGGACCCCAATGAACTGGCTGCCGTTGAGCAGGCTGGTTCCTTTTAC
AACATGGAGGTTTCCATCGCCTACCACGCCAAACCGTCTGGCGAGGACATCACGTCCAAGGCCAAGAATATGGGC
ATGCAGCTCATCTTCTACCTCGGCATCAAGGGTCTCTTCGGTGTGCCTTTGCCCGTCTGGGTCGAGCTGATAGGG
CTCGTGGCGACGGCCCGCGTGCGACTGCAGCTGACGCCAGATCCCCCCTTCCTCAAGACGCTCACCGTCACCCTC
ATGGGCGTGCCCAAGGTGCAGGCCGGCTGCACCCCCATGATAGAAAAGGGCGTCAACATCCTGAACCTGCCGCTC
ATCTCCAACTTTGTCAACTGGGCCATCCGTACGGCCGCGTCCATGTACGTGGCGCCCAAGAGCTTGACGTTGGAT
ATGAGCAAGATGCTATCGGGTGACGACATTAAGAAGGAGACGCAAGCCCTGGGCGTCATCTTTATCCGAATTCAC
AAGGCGACGGGCCTCAGCAAGCAGGACCACACGGGCAGCCGCGGCGGTGGCTCGGATCCCTACATTACGGTCAGC
TGGAGCAAGTTCTCCAAGCCTCAGTTCTGCACACGCGTCATCCAGGACGACCTGAACCCCGTCTTCGAGGAGACT
TGCGGCCTCTTGGTCACGAGCGACCTCATCAAGGCCGACGAGCAGCTGTCGATGGAGCTCTGGGACAGCGATCGT
TCGTCCGCCGACGATGTCGTGGGCAAGGTTCAGCTCAGCATCCAGAAGCTCATTCAGCACCCGGGCAAGATGTTC
CCTCAGGTCTCTCACCTGTGCGGCGTCAAGGCCGAGAGCAGCATGCCCGGTCAACTCCACTGGGAGGTGGGCTTC
TTCGGCAAGACAAAGTTCCGCAAGGCGCTGAGGACCGACGGCCGCGACGTCACCCTGCCCAAGGAGCTGGCTGAC
AAGCCCGAGCTCCAGGACCAGAGGGGCAGCATCGACAGCAAGGAGGAGGATGCCGTCGTCCACACGCCGCCCGAC
CCTCTGTGGCCGTCGGGCATCCTCAGCGTCGTCGTCCACCAGATCGTCGGCCTCGAGCTCGCCAACATCAAGGGC
TCTAACGGTAAGCGCAAGGGCCGGGAGTACGAGCCGGCGAGGCCTGAGGCGGGCGAGGTCAAGGAGGAGCAGAGT
CGGAAGCTGCCGAGCTCATACTGCACGGTCCTGATCAACGATGATCTGGTGTACAAGACACGCATCAAGGCGGTT
TCTTCGCAGCCCATCTTCAACGCCGGGACGGAAAAGTTCATCCGCGACTGGAGATCCTGCATCGCCACCGTTGCC
GTGCGCGACTCTCGGAACAGGCAGCACGACCCCATCATCGGCGTCGTGCCTCTGCAGCTGTCTGACGTGCTGCGG
ACGAGCAGCCAGTTGACGCGGTGGTATCCCCTCGACGGCGGCATCGGCTTCGGCCGGATCCGCATCTCCATCCTC
TTCCGCTCCGTCGAACTCCGACTGCCGCCGCCGCAGCTCGGCTGGGATATCGGGACGTTTGAATTCACGTCCGAC
AGCATCACCACGACGGGATACGCGCCGTCTCAGAGCGTCAAGTTGAAGCTGCGTACGGGCGGATCGTCGGCGACG
GTCAAGAAGAACATGTCGACCAGGGAAGAGACGGGAATGAGAATCGACATCAGCGGTGGGGAAGACGGGAAGCTG
ATGCGACTCCCCGTCCGTCACCGGTATCGATGCCCCATCTTCATCGAGTTTTACTCGTCGAGCAGCCGCAAGCCG
GACGCCTACGCTGCCCTGTGGCTGTTGGAGCTCAGCGACGGGGAAGAGACGGACTTTGAAGTGCCCGTCTTTACC
TGTAGCAATGGCCTGCGTCTCTCTCAGAATTACATCACCCAGGACAACTACCGGGAGATTCCCGACATGAAGATT
GAGGAGGTCGGCCGCGTCCGGTTCCGCGGCCGCTTCTCACCCGGCACCGACTCGGACCACATGAAGTTTGTCAGC
GACAACGACTCTCGAGAGACGATTGAGACGTGGGAGGCGTGCTACGCCGAAGGTGTGCGGCAGGAAGAGGTCAAG
GCGGAGGTGCCTCCGGTGGTGATGGAACTGCACGACAAGTCGTTGACGCACGGCCGAGACGTGCTCGCCCAGGCG
GACGAAGAAGCCAAGCAGCGATGGCTGGCAAAGGACGGCACGGACTGGAGCGGTGCCTTTGGCAAGGACCCCAGG
GACCTGATGGCGAACAACGCGGGGGGAGACGGCGACAGCGAGACGCGGGACGATGCGGCGGGAGAATACGACAGC
AGCGACAGCGATCCGGATCTGGGCATCGAGGAGTACCCGAGCGCGACGGGAGATGAGACGGAGAATGGCCGACCG
TCGGCGGAAACGAGGGGAGAATCGGAGTCGTCGTCTTCGTCTACGCACGACGGCAGCGGCAGCAAGAACCCGTAC
ACCTTGTACAAGACGTACACGGCACGGAACCGCGACCTGCATCGCAAGCACCGCGGGTTGATGCAGTGGCGGCCG
ATGCGCAACGCGCAGTTTGCCAAGGACGAGGCCAAGTTTGCCCTGCGCAAGGTGAAGAATTTGGGGGGGTTGGGA
GGAGACAGCCGGACGTGGAGACGGAGGTTTAGGGTTGAGGATGAGCTGTGTTTGTAGTGATTTTATTATTAGTGA
ATTGATAAGGTTAACAATTGCTGTTCGTGGCTGTAGCTTGTGAGGAACCTGTGAAGGTGTCGTGATGGGAAGAGA
GAGTGGTTGTCGTTGAAATCAGGGTAGACTACCGACGGTCTCCCTTGACGTTGACTCGTGACTCGTGACTCGTGG
CTCGTGACTCGTGACTCGTGACTCGTGACTCGTGACTTGCCGAGTCAGCAGTCGCAGGCTGCACACAGGGTAAGC
TGCCATGGTTACGGGGTTGAGGACCCCGATACCAGCTGGCTTCCATTCCCCACCAGCGCCATCAAGGCTCAACGA
AGAAACCTCTCACAGCCGCACGAAATCAATCGACGCGTCCATCTCCCCAAGATTCTCCCGCGGCGCTTCTCGCTC
ACCCCTCGATGCGGCGCAAGAGCTCCTAAACGCGCGGAGGCTCCCACGGCGACGTCGCGCCCCAAATTTGAAGCT
TCAGCCTACGGAAAGCAAACGAACGACGACGACGCGTGCGAACAAGATGCCGTCATCTGAGGCAGTCGACATCCG
ACGCTTTTTCGTTGCTCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAACAGCAGAAGCAGAAGAT
AAGCAAGAAGCGGTCTTCGCCGTCGGGCAGTGCGGACGAGGAGGATCCGTTGTTTGGGGGGGAAGAGGGGGGCGT
GAGAGCAAGGCCGGGGTTGGTGACGGGGAGGAGGAGTCTTGGGGCGACGGGGACGGGGATGGGGGCGGAGGATGT
GGCTGAGGGGGTGAGGAAGAGGAGGAAGGGGGGGATGGGAGGATGGTGGTTTCGAAGGCTGTGAAGGCGAGGAGG
AGCGCGGGGGTCTCGACACCGGTGAGGGAGACGACTGGTCCTTCATCCAGGAGAGAGACGACCGTTCCTTCATCC
AGGAGAGGAACAACCGTTCCTATACCCAGGAGGGAGACGACTGTCCCTACACCCAAGAAAGAGTCCAGGAGGGAG
TCGGCCGTCTCACTGCCCAAATTGGCGGCACGAAATGCTTCGCGATCAGCGGCGGCGACTACGACTACGACTGCG
ACGACTACGACGACTCCGACTCCGACTTCGACGTCGACGACGGTAAAGAGGCCCGTGTTGGCGGATCCCAAAAGC
CGAGGACGGCCCAAGGGCTGGCGAGCGGGCATGTCTTACTCGGAGATGCGAGGCAGGTCGCCGCCCGGTCCTCGA
GGGCGGCAGAGGCCGAAGTCGACGGCGGGTCCGGGCCTGGGCAAGCGGCGCAGACGACCGGCCAAGTCACCGTCG
CCGCCCCCGCTCGAGATGTACAGACAACTACGGCCGCGGTTCCCCGAATTCCTATGCGAGTGGACAGGGTGTAAG
GCGGAGCTGCACAACCTCGAAACGCTGCGGAGGCACGTCCTCTTCGTCCACGGCGGTTCGGGCTGTCGCTGCTTC
TGGGGCAAATGCATGGCCTCGGTGGCGACGGCCGACGAGTTCAGGTCGCATGTGGAGGAGGCGCATATGGTGCCG
GTGGCGTGGCACATGGGTGATGGGCCGCGGAACTGGAGCCGATATACGGGAGGCGATGGCGAGGATGGGCAGGTT
CCGGATTACCTGCTAGATGAGCATGGGGTGCAGGTGACGCCATCGATTCGCGACCAGGAGGTCGAGGACGTGTTG
ACGTGGCGGATGAATCGGAGGAAGCTCAAGGAGTTGCTGATTCGGAGGGATGAGAATCTGCCTGATGAAGACTCG
GACGAGGAGGGCGAGGAGGAAGAGGTTAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail