Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04333
Gene name
Locationscaffold_04:2957627..2959630
Strand+
Gene length (bp)2003
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.2E-41 150 533

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 141 163 22
2 178 197 19
3 210 227 17
4 233 255 22
5 268 290 22
6 305 327 22
7 374 396 22
8 411 430 19
9 451 473 22
10 478 500 22
11 513 535 22
12 545 567 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04333
MPMDDADREVISAEADAAAPEYYQRRNSDEVERIVSASSVSTVSSMHTPGARNRMSYISTHRDLDRHYTELSRIE
TQRTQHFGTVGSSAASVAAQHRKPLPSFGAGKPFPPPLPARDEYVVEFDGPGDPLNAQNWPTRVKVAMVAMLNYT
TFVSSFTSSIYSPAIETISKFFHVDLEVALLGTTLYVLGFAFGPSLWAPLSELRGRRMPIILSMFGFSVFCIGAA
TAKDIQTLLICRFFSGFFGSCSLAVVAAIFSDMFNNVTRGIAITCFTMTVFLGPFLAPFIGGYIVESYLGWRWTL
YLPTILGFFAFFLDLFFLKESYAPVILVGKAAELRRRTRNWGIHAKQEEIEIDLTELINKNFSRPMRMLFTEPIL
FLLTLYMSFLYGLLYLFLTAYNIVFVGIHHFSLGEAGLTFFGMIIGVLIAGIVVFAQQPWYQRKLKANNGVPVPE
WRLPSVMAGGICFVIGIFWFGWTGYKASIPWIAPAASGIFTGFGLMSIFLQSINYIVDAYLMFAASALAGNTFMR
SLAGATFPLFARQMFLGMGVQWASTLLGCLALLMCPIPFIFYKYGSRLREKSQFAPTPPRPPRSNSSDAVGDGET
LTEKRKRDRSAATSRDTAVLSTRSASAAGDESVLSGDSHSLGPRLDV*
Coding >Ophcf2|04333
ATGCCCATGGACGACGCCGACCGAGAGGTCATCTCCGCCGAGGCCGATGCCGCCGCTCCAGAGTACTACCAGCGG
CGCAATAGCGATGAGGTCGAACGTATCGTCTCGGCCTCGTCCGTCTCGACGGTCTCGTCGATGCACACGCCAGGA
GCGCGTAACCGCATGAGCTACATCTCGACTCATCGCGATCTCGACCGTCACTACACCGAGCTGAGCCGGATCGAG
ACGCAGCGGACGCAGCATTTCGGCACCGTAGGTAGCTCTGCTGCCAGTGTTGCCGCTCAGCATCGCAAGCCCTTG
CCTTCGTTTGGCGCTGGCAAGCCATTTCCGCCACCGCTGCCGGCTCGGGACGAGTATGTCGTCGAGTTTGATGGG
CCAGGCGACCCTCTCAATGCTCAGAACTGGCCTACGCGCGTCAAGGTGGCCATGGTTGCCATGCTCAACTATACT
ACCTTTGTCTCGTCCTTTACCTCGTCCATCTACTCGCCCGCCATCGAGACCATCTCCAAATTCTTTCACGTCGAC
CTCGAAGTGGCTTTGCTCGGGACGACGCTCTACGTCCTCGGCTTCGCTTTCGGGCCCTCGCTGTGGGCGCCCCTT
TCCGAGCTTCGCGGTCGTCGGATGCCCATCATTCTCTCCATGTTTGGCTTCTCCGTCTTCTGCATCGGCGCCGCT
ACGGCAAAGGATATCCAGACCCTCCTCATCTGCCGCTTCTTCTCCGGCTTCTTCGGCTCTTGTTCTCTCGCAGTC
GTCGCCGCCATCTTCTCCGACATGTTCAACAACGTGACGCGCGGCATTGCAATCACCTGCTTCACCATGACCGTC
TTCCTGGGGCCCTTTCTCGCCCCCTTTATCGGCGGCTACATTGTCGAATCCTATCTCGGCTGGCGCTGGACCTTG
TATCTGCCCACCATTCTCGGCTTCTTCGCCTTCTTCCTCGACCTCTTCTTTCTCAAGGAGTCTTACGCGCCCGTC
ATTCTCGTCGGCAAGGCTGCAGAGCTGCGCCGTCGCACTCGCAACTGGGGCATCCACGCCAAGCAGGAAGAGATT
GAGATTGACTTGACCGAGCTCATCAACAAGAACTTTTCTCGTCCCATGCGCATGCTCTTTACCGAGCCCATTCTA
TTTCTCCTCACCCTCTACATGAGCTTTCTCTACGGCTTGCTCTACCTCTTCCTCACAGCCTACAACATCGTCTTC
GTTGGCATTCATCACTTCAGCTTGGGCGAGGCCGGTCTGACCTTTTTCGGCATGATCATCGGCGTCCTCATCGCC
GGCATCGTCGTCTTCGCCCAGCAGCCGTGGTATCAGCGCAAGCTGAAGGCCAACAACGGCGTCCCGGTGCCCGAG
TGGAGGTTGCCCAGCGTCATGGCCGGTGGCATCTGCTTCGTCATCGGCATCTTCTGGTTTGGATGGACCGGATAC
AAGGCCAGCATCCCCTGGATAGCCCCGGCAGCCAGCGGCATCTTCACCGGCTTCGGACTCATGTCCATCTTTCTG
CAATCCATCAACTACATTGTCGACGCCTACCTCATGTTCGCCGCCTCTGCCCTCGCCGGCAACACCTTTATGCGC
TCCCTAGCCGGCGCCACCTTTCCGCTCTTTGCGAGGCAGATGTTTCTGGGCATGGGCGTCCAGTGGGCGTCGACA
TTGCTGGGATGTCTGGCGCTGCTCATGTGCCCTATCCCCTTCATCTTCTACAAGTACGGCAGCCGGCTCCGGGAG
AAGAGCCAGTTCGCGCCGACGCCGCCGCGGCCGCCTCGCTCCAACTCGTCCGACGCCGTCGGCGATGGTGAGACG
CTGACGGAGAAGAGGAAGCGTGATCGCTCGGCTGCCACCAGTCGGGACACGGCCGTTCTCAGCACCCGCTCGGCC
TCGGCAGCGGGTGATGAAAGCGTGCTCTCTGGGGACAGCCACAGTTTGGGCCCTCGGCTGGACGTGTAG
Transcript >Ophcf2|04333
ATGCCCATGGACGACGCCGACCGAGAGGTCATCTCCGCCGAGGCCGATGCCGCCGCTCCAGAGTACTACCAGCGG
CGCAATAGCGATGAGGTCGAACGTATCGTCTCGGCCTCGTCCGTCTCGACGGTCTCGTCGATGCACACGCCAGGA
GCGCGTAACCGCATGAGCTACATCTCGACTCATCGCGATCTCGACCGTCACTACACCGAGCTGAGCCGGATCGAG
ACGCAGCGGACGCAGCATTTCGGCACCGTAGGTAGCTCTGCTGCCAGTGTTGCCGCTCAGCATCGCAAGCCCTTG
CCTTCGTTTGGCGCTGGCAAGCCATTTCCGCCACCGCTGCCGGCTCGGGACGAGTATGTCGTCGAGTTTGATGGG
CCAGGCGACCCTCTCAATGCTCAGAACTGGCCTACGCGCGTCAAGGTGGCCATGGTTGCCATGCTCAACTATACT
ACCTTTGTCTCGTCCTTTACCTCGTCCATCTACTCGCCCGCCATCGAGACCATCTCCAAATTCTTTCACGTCGAC
CTCGAAGTGGCTTTGCTCGGGACGACGCTCTACGTCCTCGGCTTCGCTTTCGGGCCCTCGCTGTGGGCGCCCCTT
TCCGAGCTTCGCGGTCGTCGGATGCCCATCATTCTCTCCATGTTTGGCTTCTCCGTCTTCTGCATCGGCGCCGCT
ACGGCAAAGGATATCCAGACCCTCCTCATCTGCCGCTTCTTCTCCGGCTTCTTCGGCTCTTGTTCTCTCGCAGTC
GTCGCCGCCATCTTCTCCGACATGTTCAACAACGTGACGCGCGGCATTGCAATCACCTGCTTCACCATGACCGTC
TTCCTGGGGCCCTTTCTCGCCCCCTTTATCGGCGGCTACATTGTCGAATCCTATCTCGGCTGGCGCTGGACCTTG
TATCTGCCCACCATTCTCGGCTTCTTCGCCTTCTTCCTCGACCTCTTCTTTCTCAAGGAGTCTTACGCGCCCGTC
ATTCTCGTCGGCAAGGCTGCAGAGCTGCGCCGTCGCACTCGCAACTGGGGCATCCACGCCAAGCAGGAAGAGATT
GAGATTGACTTGACCGAGCTCATCAACAAGAACTTTTCTCGTCCCATGCGCATGCTCTTTACCGAGCCCATTCTA
TTTCTCCTCACCCTCTACATGAGCTTTCTCTACGGCTTGCTCTACCTCTTCCTCACAGCCTACAACATCGTCTTC
GTTGGCATTCATCACTTCAGCTTGGGCGAGGCCGGTCTGACCTTTTTCGGCATGATCATCGGCGTCCTCATCGCC
GGCATCGTCGTCTTCGCCCAGCAGCCGTGGTATCAGCGCAAGCTGAAGGCCAACAACGGCGTCCCGGTGCCCGAG
TGGAGGTTGCCCAGCGTCATGGCCGGTGGCATCTGCTTCGTCATCGGCATCTTCTGGTTTGGATGGACCGGATAC
AAGGCCAGCATCCCCTGGATAGCCCCGGCAGCCAGCGGCATCTTCACCGGCTTCGGACTCATGTCCATCTTTCTG
CAATCCATCAACTACATTGTCGACGCCTACCTCATGTTCGCCGCCTCTGCCCTCGCCGGCAACACCTTTATGCGC
TCCCTAGCCGGCGCCACCTTTCCGCTCTTTGCGAGGCAGATGTTTCTGGGCATGGGCGTCCAGTGGGCGTCGACA
TTGCTGGGATGTCTGGCGCTGCTCATGTGCCCTATCCCCTTCATCTTCTACAAGTACGGCAGCCGGCTCCGGGAG
AAGAGCCAGTTCGCGCCGACGCCGCCGCGGCCGCCTCGCTCCAACTCGTCCGACGCCGTCGGCGATGGTGAGACG
CTGACGGAGAAGAGGAAGCGTGATCGCTCGGCTGCCACCAGTCGGGACACGGCCGTTCTCAGCACCCGCTCGGCC
TCGGCAGCGGGTGATGAAAGCGTGCTCTCTGGGGACAGCCACAGTTTGGGCCCTCGGCTGGACGTGTAG
Gene >Ophcf2|04333
ATGCCCATGGACGACGCCGACCGAGAGGTCATCTCCGCCGAGGCCGATGCCGCCGCTCCAGAGTACTACCAGCGG
CGCAATAGCGATGAGGTCGAACGTATCGTCTCGGCCTCGTCCGTCTCGACGGTCTCGTCGATGCACACGCCAGGA
GCGCGTAACCGCATGAGCTACATCTCGACTCATCGCGATCTCGACCGTCACTACACCGAGCTGAGCCGGATCGAG
ACGCAGCGGACGCAGCATTTCGGCACCGTAGGTAGCTCTGCTGCCAGTGTTGCCGCTCAGCATCGCAAGCCCTTG
CCTTCGTTTGGCGCTGGCAAGCCATTTCCGCCACCGCTGCCGGCTCGGGACGAGTATGTCGTCGAGTTTGATGGG
CCAGGCGACCCTCTCAATGCTCAGAACTGGCCTACGCGCGTCAAGGTGGCCATGGTTGCCATGCTCAACTATACT
ACCTTTGTCTCGTCCTTTACCTCGTCCATCTACTCGCCCGCCATCGAGACCATCTCCAAATTCTTTCACGTCGAC
CTCGAAGTGGCTTTGCTCGGGACGACGCTCTACGTCCTCGGCTTCGCTTTCGGGCCCTCGCTGTGGGCGCCCCTT
TCCGAGCTTCGCGGTCGTCGGATGCCCATCATTCTCTCCATGTTTGGCTTCTCCGTCTTCTGCATCGGCGCCGCT
ACGGCAAAGGATATCCAGACCCTCCTCATCTGCCGCTTCTTCTCCGGCTTCTTCGGCTCTTGTTCTCTCGCAGTC
GTCGCCGCCATCTTCTCCGACATGTTCAACAACGTGACGCGCGGCATTGCAATCACCTGCTTCACCATGACCGTC
TTCCTGGGGCCCTTTCTCGCCCCCTTTATCGGCGGCTACATTGTCGAATCCTATCTCGGCTGGCGCTGGACCTTG
TATCTGCCCACCATTCTCGGCTTCTTCGCCTTCTTCCTCGACCTCTTCTTTCTCAAGGAGTCTTACGCGCCCGTC
ATTCTCGTCGGCAAGGCTGCAGAGCTGCGCCGTCGCACTCGCAACTGGGGCATCCACGCCAAGCAGGAAGAGATT
GAGATTGACTTGACCGAGCTCATCAACAAGAACTTTTCTCGTCCCATGCGCATGCTCTTTACCGAGCCCATTCTA
TTTCTCCTCACCCTCTACATGAGCTTTCTCTACGGCTTGCTCTACCTCTTCCTCACAGCCTACAACATCGTCTTC
GTTGGCATTCATCACTTCAGCTTGGGCGAGGCCGGTCTGACCTTTTTCGGCATGATCATCGGCGTCCTCATCGCC
GGCATCGTCGTCTTCGCCCAGCAGCCGTGGTATCAGCGCAAGCTGAAGGCCAACAACGGCGTCCCGGTGCCCGAG
TGGAGGTTGCCCAGCGTCATGGCCGGTGGCATCTGCTTCGTCATCGGCATCTTCTGGTTTGGATGGTACGTTTGA
ATATACGCCTTCTTTACTCGTAAGGGCATCTGCTGACATGACGATGCAGGACCGGATACAAGGCCAGCATCCCCT
GGATAGCCCCGGCAGCCAGCGGCATCTTCACCGGCTTCGGACTCATGTCCATCTTTCTGCAATCCATCAACTACA
TTGTCGACGCCTACCTCATGTTCGCCGCCTCTGCCCTCGCCGGCAACACCTTTATGCGCTCCCTAGCCGGCGCCA
CCTTTCCGCTCTTTGCGAGGCAGATGTTTCTGGGCATGGGCGTCCAGTGGGCGTCGACATTGCTGGGATGTCTGG
CGCTGCTCATGTGCCCTATCCCCTTCATCTTCTACAAGTACGGCAGCCGGCTCCGGGAGAAGAGCCAGTTCGCGC
CGACGCCGCCGCGGCCGCCTCGCTCCAACTCGTCCGACGCCGTCGGCGATGGTGAGACGCTGACGGAGAAGAGGA
AGCGTGATCGCTCGGCTGCCACCAGTCGGGACACGGCCGTTCTCAGCACCCGCTCGGCCTCGGCAGCGGGTGATG
AAAGCGTGCTCTCTGGGGACAGCCACAGTTTGGGCCCTCGGCTGGACGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail