Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04329
Gene name
Locationscaffold_04:2943634..2944698
Strand-
Gene length (bp)1064
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 3.9E-17 68 255
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 1.7E-06 66 260

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.1016 0.06 0.7993 0.3553 0.107 0.0587 0.173 0.2609 0.1879 0.0158

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999711

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
CE3 1.5E-40 64 262

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup547
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4177
Ophiocordyceps australis map64 (Brazil) OphauB2|6260
Ophiocordyceps camponoti-floridani Ophcf2|04329 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3726
Ophiocordyceps kimflemingae Ophio5|1611
Ophiocordyceps subramaniannii Hirsu2|3955
Ophiocordyceps subramaniannii Hirsu2|5674

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04329
MRASLPVAVCCLLGLAAATVERDLMVQARRLVVRADNYSSPVLNPRQTLPTPSNRLANRPGPQLRILCAGDSITA
GTFSDLDGGDGNGYRLRLRDDLSADRVIFTGTEAAPNGTMNDGVFAAWPGKTIKFITDNIGPSLKQRPNLVLLHA
GTNDMNPNPAISTEGNDPTEAAKRLGVLVDRIVDACPDAVVLVAMIIPTCDQAQAPATREFQRQIPDMVRQRSGV
GKRVLATNITSFPTDQLRDCIHPTNDGYRLLGDYWSDFAAQVPDDWLHDPVQVSLDEASPSSSLGAPWPSVWRVA
AAIMVGSGIMTVM*
Coding >Ophcf2|04329
ATGCGGGCCTCTCTACCGGTGGCCGTCTGCTGCCTGCTCGGGCTCGCCGCAGCCACCGTCGAACGAGACCTGATG
GTCCAGGCCCGGCGGCTGGTGGTCAGGGCTGACAATTACTCGAGTCCCGTCTTGAATCCACGCCAGACGCTGCCG
ACGCCGAGCAATCGCCTTGCCAATCGTCCCGGGCCGCAGCTGCGCATCCTGTGCGCCGGCGACTCCATCACGGCC
GGTACCTTTAGCGACTTAGACGGCGGCGACGGAAATGGCTATAGACTTCGGCTGCGAGACGACTTGTCGGCCGAT
AGGGTTATCTTTACAGGAACCGAGGCGGCGCCGAACGGGACGATGAACGACGGTGTCTTTGCGGCCTGGCCCGGA
AAGACGATCAAGTTCATCACCGACAACATCGGCCCGTCGCTGAAGCAACGGCCAAACTTGGTCCTTCTGCACGCG
GGGACCAATGACATGAATCCCAATCCCGCCATCTCGACCGAGGGCAACGATCCGACCGAGGCGGCGAAACGATTG
GGCGTGCTGGTGGACCGAATCGTCGATGCGTGTCCGGACGCCGTCGTCCTTGTAGCCATGATCATCCCCACATGC
GACCAGGCGCAGGCGCCGGCAACGCGCGAGTTCCAGCGGCAAATCCCGGACATGGTGCGGCAGCGGTCCGGAGTC
GGGAAACGCGTGCTGGCGACCAACATCACGTCGTTTCCCACCGACCAGCTGAGGGACTGCATCCACCCGACCAAC
GACGGGTACCGGTTGCTTGGAGACTACTGGTCCGATTTCGCGGCCCAAGTTCCCGATGACTGGCTGCACGACCCG
GTTCAAGTCAGCCTCGACGAAGCGTCACCGAGCAGCAGTCTGGGCGCGCCGTGGCCGTCCGTGTGGCGGGTGGCG
GCGGCAATAATGGTAGGCAGCGGCATAATGACCGTGATGTAG
Transcript >Ophcf2|04329
ATGCGGGCCTCTCTACCGGTGGCCGTCTGCTGCCTGCTCGGGCTCGCCGCAGCCACCGTCGAACGAGACCTGATG
GTCCAGGCCCGGCGGCTGGTGGTCAGGGCTGACAATTACTCGAGTCCCGTCTTGAATCCACGCCAGACGCTGCCG
ACGCCGAGCAATCGCCTTGCCAATCGTCCCGGGCCGCAGCTGCGCATCCTGTGCGCCGGCGACTCCATCACGGCC
GGTACCTTTAGCGACTTAGACGGCGGCGACGGAAATGGCTATAGACTTCGGCTGCGAGACGACTTGTCGGCCGAT
AGGGTTATCTTTACAGGAACCGAGGCGGCGCCGAACGGGACGATGAACGACGGTGTCTTTGCGGCCTGGCCCGGA
AAGACGATCAAGTTCATCACCGACAACATCGGCCCGTCGCTGAAGCAACGGCCAAACTTGGTCCTTCTGCACGCG
GGGACCAATGACATGAATCCCAATCCCGCCATCTCGACCGAGGGCAACGATCCGACCGAGGCGGCGAAACGATTG
GGCGTGCTGGTGGACCGAATCGTCGATGCGTGTCCGGACGCCGTCGTCCTTGTAGCCATGATCATCCCCACATGC
GACCAGGCGCAGGCGCCGGCAACGCGCGAGTTCCAGCGGCAAATCCCGGACATGGTGCGGCAGCGGTCCGGAGTC
GGGAAACGCGTGCTGGCGACCAACATCACGTCGTTTCCCACCGACCAGCTGAGGGACTGCATCCACCCGACCAAC
GACGGGTACCGGTTGCTTGGAGACTACTGGTCCGATTTCGCGGCCCAAGTTCCCGATGACTGGCTGCACGACCCG
GTTCAAGTCAGCCTCGACGAAGCGTCACCGAGCAGCAGTCTGGGCGCGCCGTGGCCGTCCGTGTGGCGGGTGGCG
GCGGCAATAATGGTAGGCAGCGGCATAATGACCGTGATGTAG
Gene >Ophcf2|04329
ATGCGGGCCTCTCTACCGGTGGCCGTCTGCTGCCTGCTCGGGCTCGCCGCAGCCACCGTCGAACGAGACCTGATG
GTCCAGGCCCGGCGGCTGGTGGTCAGGGCTGACAATTACTCGAGTCCCGTCTTGAATCCACGCCAGACGCTGCCG
ACGCCGAGCAATCGCCTTGCCAATCGTCCCGGGCCGCAGCTGCGCATCCTGTGCGCCGGCGACTCCATCACGGCC
GGTACCTTTAGCGACTTAGACGGCGGCGACGGAAATGGCTATAGACTTCGGCTGCGAGACGACTTGTCGGGTGAG
TCGTCCATGTGCGACGCTGACATCGGGGCTTGTCAACTGACAGTCGATTGTCTCAGCCGATAGGGTTATCTTTAC
AGGAACCGAGGCGGCGCCGAACGGGACGATGAACGACGGTGTCTTTGTGAGTCGACCGTGGTCGGTCTTGAGCGC
GGGACGACACTGATACTTGGCGTTTCCTACAGGCGGCCTGGCCCGGAAAGACGATCAAGTTCATCACCGACAACA
TCGGCCCGTCGCTGAAGCAACGGCCAAACTTGGTCCTTCTGCACGCGGGGACCAATGACATGAATCCCAATCCCG
CCATCTCGACCGAGGGCAACGATCCGACCGAGGCGGCGAAACGATTGGGCGTGCTGGTGGACCGAATCGTCGATG
CGTGTCCGGACGCCGTCGTCCTTGTAGCCATGATCATCCCCACATGCGACCAGGCGCAGGCGCCGGCAACGCGCG
AGTTCCAGCGGCAAATCCCGGACATGGTGCGGCAGCGGTCCGGAGTCGGGAAACGCGTGCTGGCGACCAACATCA
CGTCGTTTCCCACCGACCAGCTGAGGGACTGCATCCACCCGACCAACGACGGGTACCGGTTGCTTGGAGACTACT
GGTCCGATTTCGCGGCCCAAGTTCCCGATGACTGGCTGCACGACCCGGTTCAAGTCAGCCTCGACGAAGCGTCAC
CGAGCAGCAGTCTGGGCGCGCCGTGGCCGTCCGTGTGGCGGGTGGCGGCGGCAATAATGGTAGGCAGCGGCATAA
TGACCGTGATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail