Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04323
Gene name
Locationscaffold_04:2927600..2929893
Strand+
Gene length (bp)2293
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00153 Mito_carr Mitochondrial carrier protein 1.9E-19 254 356
PF00153 Mito_carr Mitochondrial carrier protein 4.9E-19 367 458
PF00153 Mito_carr Mitochondrial carrier protein 8.2E-27 477 564
PF13499 EF-hand_7 EF-hand domain pair 1.6E-09 22 83
PF13499 EF-hand_7 EF-hand domain pair 6.1E-12 87 148
PF00036 EF-hand_1 EF hand 3.2E-06 58 83
PF00036 EF-hand_1 EF hand 2.8E-06 125 149
PF13405 EF-hand_6 EF-hand domain 3.6E-05 92 116
PF13202 EF-hand_5 EF hand 1.7E-01 59 80
PF13202 EF-hand_5 EF hand 7.3E-04 92 111
PF13202 EF-hand_5 EF hand 5.7E-06 127 149
PF13833 EF-hand_8 EF-hand domain pair 2.8E-02 38 83
PF13833 EF-hand_8 EF-hand domain pair 5.9E-05 101 148

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2415 0.1063 0.0454 0.2402 0.8983 0.1345 0.1529 0.1313 0.1555 0.1808

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2197
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4184
Ophiocordyceps australis map64 (Brazil) OphauB2|6254
Ophiocordyceps camponoti-floridani Ophcf2|04323 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7169
Ophiocordyceps kimflemingae Ophio5|1165
Ophiocordyceps subramaniannii Hirsu2|2740

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04323
MRRPKKREPDESQLQRDVRLGALWEQLDPDHAGELDLKGLRRGLRKIDHPLKNADHLLKQIMEEVDTNHDGKMQF
QEFCTFVRQAEKKLLPLFRSIDKDGNGKLDMAELQSAFRASGLTVSNRKLSEFFNDMDRNHDGFISFDEWRNFLL
LMPARQNDSQLAAVLSYYFAVVNVTPEGDSIVREDTLEGTEARTPNMDVPEGAADLFVDIAATAGPPDKGKGIKA
EANGDGTSDQSLGKAKKLRLTDLAPDPGYFLAGAIAGGLSRTATAPLDRLKVYLLVNTKSESQTATAALKQGRLV
AAARNALRPLGDAVKDVYRSGGLSGFFAGNGLNVVKIMPETAIKFGTYEAAKRAFAEWEGHGDPRRISSISKFTA
GGVAGMMAQFCVYPLDTLKFRLQCETVKGGLTGTALVRQTAINMYADGGLRSCYRGVTMGLVGMFPYSAIDMTMF
ELLKSTYRTRYARRTGCHEDDANPGNMATGIIGATSGAIGASVVYPLNVVRTRLQTQGTAGHRDTYTGIWDVARK
TYRREGLRGFYKGLTPNLLKVAPALSITWVVYENSKRLLGLR*
Coding >Ophcf2|04323
ATGAGGCGGCCCAAGAAGCGCGAGCCAGACGAGTCGCAGCTCCAGCGCGATGTCCGCCTCGGGGCTCTCTGGGAA
CAGCTCGACCCTGACCATGCGGGCGAGCTGGACCTCAAGGGCCTCCGAAGAGGACTGCGCAAGATTGATCATCCA
CTGAAGAATGCCGACCATCTGTTGAAGCAGATAATGGAAGAGGTCGATACGAATCACGACGGCAAGATGCAGTTT
CAGGAGTTCTGCACATTCGTTCGGCAAGCAGAGAAGAAGCTTCTCCCCCTCTTCAGATCCATAGACAAAGATGGC
AACGGAAAGCTCGACATGGCGGAGCTTCAATCGGCCTTTAGAGCATCAGGCTTGACCGTCTCGAACCGCAAGCTG
TCCGAGTTTTTCAACGACATGGACAGGAACCACGATGGCTTCATCAGCTTTGACGAGTGGAGAAACTTTCTCCTC
TTAATGCCTGCTCGGCAGAACGACTCGCAGCTCGCAGCCGTCTTGTCCTATTACTTTGCCGTTGTCAACGTCACT
CCCGAGGGAGACTCGATTGTCAGGGAAGACACCTTGGAGGGAACAGAGGCTCGCACACCCAATATGGACGTCCCG
GAAGGTGCTGCAGACTTGTTTGTTGACATTGCAGCCACTGCCGGGCCACCCGATAAAGGCAAAGGCATAAAGGCG
GAAGCGAACGGCGATGGCACCTCGGACCAGAGCTTGGGAAAAGCCAAAAAGCTGAGGCTGACAGACCTTGCCCCC
GATCCAGGTTACTTTCTCGCGGGTGCCATCGCCGGCGGACTGTCACGTACAGCGACTGCGCCCCTCGACCGACTC
AAAGTCTACCTTCTCGTCAACACCAAGAGCGAGTCTCAGACGGCGACTGCGGCCCTCAAGCAGGGGCGTCTCGTG
GCGGCGGCGAGAAACGCTCTGCGGCCGCTGGGCGATGCCGTCAAGGATGTATATCGATCCGGCGGCCTGAGCGGC
TTCTTCGCCGGCAACGGGCTCAACGTGGTCAAGATCATGCCCGAGACGGCCATCAAGTTCGGAACCTACGAGGCG
GCCAAGCGAGCCTTTGCCGAGTGGGAGGGCCATGGAGACCCGAGACGGATCAGCTCCATCTCCAAGTTCACGGCG
GGAGGCGTTGCCGGCATGATGGCCCAGTTCTGCGTATATCCGCTCGACACGCTCAAGTTCCGGTTGCAGTGCGAG
ACGGTCAAGGGAGGCCTCACGGGGACGGCCCTGGTACGGCAGACGGCCATCAACATGTACGCCGACGGCGGTCTG
CGATCGTGCTACCGAGGCGTCACCATGGGCCTGGTAGGAATGTTCCCCTACAGCGCCATCGACATGACCATGTTC
GAGCTCCTCAAGTCGACCTACCGAACCCGTTACGCCCGCCGCACGGGCTGTCACGAAGACGACGCCAACCCGGGC
AACATGGCGACGGGCATCATCGGCGCCACATCAGGCGCCATCGGAGCAAGCGTCGTCTACCCTCTGAACGTGGTA
CGCACCCGTCTCCAGACGCAGGGCACCGCCGGTCACCGCGACACCTACACGGGCATCTGGGACGTGGCGCGCAAG
ACGTACCGACGCGAGGGTCTCAGGGGCTTCTACAAGGGCCTGACGCCCAACCTGCTGAAAGTCGCTCCTGCGCTG
AGCATAACATGGGTCGTGTACGAGAACTCGAAGCGGTTACTTGGCCTGCGCTGA
Transcript >Ophcf2|04323
ATGAGGCGGCCCAAGAAGCGCGAGCCAGACGAGTCGCAGCTCCAGCGCGATGTCCGCCTCGGGGCTCTCTGGGAA
CAGCTCGACCCTGACCATGCGGGCGAGCTGGACCTCAAGGGCCTCCGAAGAGGACTGCGCAAGATTGATCATCCA
CTGAAGAATGCCGACCATCTGTTGAAGCAGATAATGGAAGAGGTCGATACGAATCACGACGGCAAGATGCAGTTT
CAGGAGTTCTGCACATTCGTTCGGCAAGCAGAGAAGAAGCTTCTCCCCCTCTTCAGATCCATAGACAAAGATGGC
AACGGAAAGCTCGACATGGCGGAGCTTCAATCGGCCTTTAGAGCATCAGGCTTGACCGTCTCGAACCGCAAGCTG
TCCGAGTTTTTCAACGACATGGACAGGAACCACGATGGCTTCATCAGCTTTGACGAGTGGAGAAACTTTCTCCTC
TTAATGCCTGCTCGGCAGAACGACTCGCAGCTCGCAGCCGTCTTGTCCTATTACTTTGCCGTTGTCAACGTCACT
CCCGAGGGAGACTCGATTGTCAGGGAAGACACCTTGGAGGGAACAGAGGCTCGCACACCCAATATGGACGTCCCG
GAAGGTGCTGCAGACTTGTTTGTTGACATTGCAGCCACTGCCGGGCCACCCGATAAAGGCAAAGGCATAAAGGCG
GAAGCGAACGGCGATGGCACCTCGGACCAGAGCTTGGGAAAAGCCAAAAAGCTGAGGCTGACAGACCTTGCCCCC
GATCCAGGTTACTTTCTCGCGGGTGCCATCGCCGGCGGACTGTCACGTACAGCGACTGCGCCCCTCGACCGACTC
AAAGTCTACCTTCTCGTCAACACCAAGAGCGAGTCTCAGACGGCGACTGCGGCCCTCAAGCAGGGGCGTCTCGTG
GCGGCGGCGAGAAACGCTCTGCGGCCGCTGGGCGATGCCGTCAAGGATGTATATCGATCCGGCGGCCTGAGCGGC
TTCTTCGCCGGCAACGGGCTCAACGTGGTCAAGATCATGCCCGAGACGGCCATCAAGTTCGGAACCTACGAGGCG
GCCAAGCGAGCCTTTGCCGAGTGGGAGGGCCATGGAGACCCGAGACGGATCAGCTCCATCTCCAAGTTCACGGCG
GGAGGCGTTGCCGGCATGATGGCCCAGTTCTGCGTATATCCGCTCGACACGCTCAAGTTCCGGTTGCAGTGCGAG
ACGGTCAAGGGAGGCCTCACGGGGACGGCCCTGGTACGGCAGACGGCCATCAACATGTACGCCGACGGCGGTCTG
CGATCGTGCTACCGAGGCGTCACCATGGGCCTGGTAGGAATGTTCCCCTACAGCGCCATCGACATGACCATGTTC
GAGCTCCTCAAGTCGACCTACCGAACCCGTTACGCCCGCCGCACGGGCTGTCACGAAGACGACGCCAACCCGGGC
AACATGGCGACGGGCATCATCGGCGCCACATCAGGCGCCATCGGAGCAAGCGTCGTCTACCCTCTGAACGTGGTA
CGCACCCGTCTCCAGACGCAGGGCACCGCCGGTCACCGCGACACCTACACGGGCATCTGGGACGTGGCGCGCAAG
ACGTACCGACGCGAGGGTCTCAGGGGCTTCTACAAGGGCCTGACGCCCAACCTGCTGAAAGTCGCTCCTGCGCTG
AGCATAACATGGGTCGTGTACGAGAACTCGAAGCGGTTACTTGGCCTGCGCTGA
Gene >Ophcf2|04323
ATGAGGCGGCCCAAGAAGCGCGAGCCAGACGAGTCGCAGCTCCAGCGCGATGTCCGCCTCGGGGCTCTCTGGGAA
CAGCTCGACCCTGACCATGCGGGCGAGCTGGACCTCAAGGGCCTCCGAAGAGGACTGCGCAAGATTGATCATCGT
GAGATTTTCCGCTGCTCTCAGTCAGCGCCTGGCTCTTCCGAGGGGAGAAGACGGAACATATGGATGGCTGAGCGA
TACTTGCAGCACTGAAGAATGCCGACCATCTGTTGAAGCAGATAATGGAAGAGGTCGATACGAATCACGACGGCA
AGATGCAGTTTCAGGGTACGCTACGGTCGTTTTCGACCATCGGGTCTTCATACCTCGACACCGTCGCCCCTATAT
CGATGAGATCGCTTACAGTTGAGTTGCTATGCAGAGTTCTGCACATTCGTTCGGCAAGCAGAGAAGAAGCTTCTC
CCCCTCTTCAGATCCATAGACAAAGATGGCAACGGAAAGCTCGACATGGCGGAGCTTCAATCGGCCTTTAGAGCA
TCAGGCTTGACCGTCTCGAACCGCAAGCTGTCCGAGTTTTTCAACGACATGGACAGGAACCACGATGGCTTCATC
AGCTTTGACGAGTGGAGGCAAGTTTTCTTGGATATGGTCTCTTATTGTGGTTACGGTGGTTGGCTCGCGTGCTGG
AAAACGCGTGATAAGGCGTGTCATGTGCCTCGGTTTGCCATGGTGACGGGAGCGCGAGGGGACACTCGACTTTGC
TCATTGGCCCAGCTTCGACAGCTACGAGATTATGGCGGTTGCTGACCCTATTTTCAGAAACTTTCTCCTCTTAAT
GCCTGCTCGGCAGAACGACTCGCAGCTCGCAGCCGTCTTGTCCTATTACTTTGCCGTTGTCAACGTCACTCCCGA
GGGAGACTCGATTGTCAGGGAAGACACCTTGGAGGGAACAGGTACGGGCGGTTCTTCGTCATCTCTTTTCTCTTA
TCTTTTCCACGTCCTCGTCGGCTCCTTGGTCAGAATCGCCTCCAGCTCAACTCGCCCTCTATCACCACCATCCGC
AGAGGCTCGCACACCCAATATGGACGTCCCGGAAGGTGCTGCAGACTTGTTTGTTGACATTGCAGCCACTGCCGG
GCCACCCGATAAAGGCAAAGGCATAAAGGCGGAAGCGAACGGCGATGGCACCTCGGACCAGAGCTTGGGAAAAGC
CAAAAAGCTGAGGCTGACAGACCTTGCCCCCGATCCAGGTTACTTTCTCGCGGGTGCCATCGCCGGCGGACTGTC
ACGTACAGCGACTGCGCCCCTCGACCGACTCAAAGTCTACCTTCTCGTCAACACCAAGAGCGAGTCTCAGACGGC
GACTGCGGCCCTCAAGCAGGGGCGTCTCGTGGCGGCGGCGAGAAACGCTCTGCGGCCGCTGGGCGATGCCGTCAA
GGATGTATATCGATCCGGCGGCCTGAGCGGCTTCTTCGCCGGTATGGCAGCCAACGCATCTTTTCTTCCTGGCTC
GACGCTAAAGGGGGTTTCGCAGGCAACGGGCTCAACGTGGTCAAGATCATGCCCGAGACGGCCATCAAGTTCGGA
ACCTACGAGGCGGCCAAGCGAGCCTTTGCCGAGTGGGAGGGCCATGGAGACCCGAGACGGATCAGCTCCATCTCC
AAGTTCACGGCGGGAGGCGTTGCCGGCATGATGGCCCAGTGAGCCATGGCTGAGAGAAGCAGCCGAGGGATGAGC
CGCTGATGAGATCAGGTTCTGCGTATATCCGCTCGACACGCTCAAGTTCCGGTTGCAGTGCGAGACGGTCAAGGG
AGGCCTCACGGGGACGGCCCTGGTACGGCAGACGGCCATCAACATGTACGCCGACGGCGGTCTGCGATCGTGCTA
CCGAGGCGTCACCATGGGCCTGGTAGGAATGTTCCCCTACAGCGCCATCGACATGACCATGTTCGAGCTCCTCAA
GTCGACCTACCGAACCCGTTACGCCCGCCGCACGGGCTGTCACGAAGACGACGCCAACCCGGGCAACATGGCGAC
GGGCATCATCGGCGCCACATCAGGCGCCATCGGAGCAAGCGTCGTCTACCCTCTGAACGTGGTACGCACCCGTCT
CCAGACGCAGGGCACCGCCGGTCACCGCGACACCTACACGGGCATCTGGGACGTGGCGCGCAAGACGTACCGACG
CGAGGGTCTCAGGGGCTTCTACAAGGGCCTGACGCCCAACCTGCTGAAAGTCGCTCCTGCGCTGAGCATAACATG
GGTCGTGTACGAGAACTCGAAGCGGTTACTTGGCCTGCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail