Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04316
Gene name
Locationscaffold_04:2910487..2912352
Strand-
Gene length (bp)1865
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 4.3E-12 186 248
PF00013 KH_1 KH domain 1.7E-15 286 349
PF00013 KH_1 KH domain 1.7E-15 389 451

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4072 0.9076 0.1056 0.0122 0.0324 0.009 0.0498 0.0062 0.0036 0.0008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2104
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3967
Ophiocordyceps australis map64 (Brazil) OphauB2|2543
Ophiocordyceps camponoti-floridani Ophcf2|04316 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4960
Ophiocordyceps kimflemingae Ophio5|1157
Ophiocordyceps subramaniannii Hirsu2|2480

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04316
MAEPQPDIQSILAALASQRPPHSGPTQTPPGLPGHGYPGPAPSSQSAGYQPPPPNTGAPPYGAPVHGLPAPAVSG
NVDLSAIRPVTSGTMNFDDAGSKARPFASDKAPAPPDRPLGYGGDARNNDRSYRRSRSRSPRAEFNRDERGGGHY
GRDRSYSPPPRGRTFSPRGGNGRQRSPLRGADDNSETIQIESSLVGLIIGRQGENLRRIETDSKCRVQFLAASDG
VPFRQCRISGPRQRRAEVKAAINRIIDDSGMGALNRPQDKSRDAARVTGSTSLRDGEDHMQIMVPDRTVGLIIGR
GGETIRDLQERSGCHINIVGESKSVNGLRPVNLIGTVEAAARAKDFIMEIVDSDTRGDGPAVKKPPVASRAEAPP
RDMGGGAQDKANDVIYVPSDAVGMIIGKGGETIRDMQNSTGCKINVAQSSGPGEVQREIALIGSRDSIVRAKQAI
DEKVDAVRSKSGGGGVGVGGGGGGGGGGGGGGGGGRSRGQPDMERAAYSQQSSTNQAPAAAGDASDPYAQYGGYQ
NYVALWYQSLMYQQQQQQQGGQGASTGASAGAPAPGAQ*
Coding >Ophcf2|04316
ATGGCTGAACCGCAACCCGACATTCAAAGCATTCTTGCAGCGCTAGCTTCTCAGCGTCCACCTCATTCTGGCCCG
ACTCAAACACCTCCTGGCCTCCCGGGCCATGGCTATCCCGGGCCAGCCCCGTCTTCGCAGTCAGCTGGTTACCAG
CCGCCGCCCCCTAACACCGGCGCACCTCCCTATGGTGCCCCTGTTCATGGTCTGCCTGCGCCTGCTGTCAGCGGA
AATGTTGATCTGAGTGCCATTCGACCCGTGACATCGGGCACCATGAACTTCGACGATGCTGGTTCCAAGGCAAGG
CCATTCGCCTCCGACAAGGCTCCTGCGCCCCCGGATCGGCCGCTCGGGTATGGCGGTGATGCCAGAAACAACGAT
CGATCATATCGAAGATCAAGATCCCGCTCCCCGAGAGCCGAATTCAATCGGGATGAGCGCGGTGGAGGACACTAC
GGACGCGATCGCTCTTATTCACCCCCTCCTCGTGGCCGGACATTCTCCCCCCGTGGAGGCAATGGCCGGCAAAGA
TCCCCGCTGCGAGGTGCCGACGACAACTCGGAGACGATACAGATAGAGTCTAGCCTGGTTGGTTTGATTATTGGT
CGACAAGGCGAGAATCTCCGCCGAATAGAGACGGACTCAAAATGTCGCGTTCAGTTCCTGGCAGCCTCCGATGGT
GTTCCTTTCCGGCAATGCAGAATCTCGGGTCCGCGCCAACGCCGCGCCGAGGTGAAAGCTGCCATCAACCGCATC
ATCGACGACAGCGGAATGGGCGCCTTGAATCGGCCGCAGGACAAGTCGAGAGATGCGGCCCGTGTCACCGGGTCG
ACGTCACTGCGAGACGGCGAGGATCATATGCAGATCATGGTTCCGGATCGAACGGTGGGACTCATCATAGGCCGT
GGCGGTGAAACGATCCGCGATCTACAGGAACGATCGGGTTGTCACATTAATATCGTTGGAGAGTCAAAGAGCGTT
AACGGTTTGCGGCCAGTGAATCTGATAGGGACGGTTGAGGCTGCGGCCCGAGCCAAGGATTTCATCATGGAGATT
GTCGACAGTGACACTCGAGGCGACGGTCCCGCAGTGAAGAAACCTCCCGTCGCCAGCCGAGCTGAGGCGCCGCCA
AGGGACATGGGCGGAGGCGCGCAGGACAAGGCCAACGACGTCATCTACGTCCCGTCCGATGCAGTAGGCATGATC
ATCGGCAAGGGAGGCGAGACCATACGGGATATGCAGAACAGCACTGGGTGCAAGATCAACGTGGCACAATCGTCC
GGGCCTGGTGAGGTGCAGCGAGAGATTGCTTTGATCGGCTCGCGAGATAGTATCGTTCGAGCGAAGCAGGCCATC
GACGAGAAGGTGGATGCCGTGAGATCAAAGAGCGGCGGCGGCGGAGTTGGAGTTGGAGGAGGAGGAGGAGGAGGA
GGAGGAGGAGGAGGAGGAGGAGGAGGCGGCCGGAGCCGTGGCCAGCCCGACATGGAACGGGCTGCCTACTCGCAG
CAGTCATCGACTAACCAAGCGCCGGCAGCTGCAGGCGACGCGTCCGACCCCTACGCCCAATATGGCGGATACCAA
AACTACGTGGCGCTCTGGTACCAATCGCTGATGTACCAGCAGCAGCAGCAGCAACAGGGCGGACAAGGAGCGTCG
ACCGGAGCATCGGCTGGAGCGCCGGCGCCGGGAGCTCAGTGA
Transcript >Ophcf2|04316
ATGGCTGAACCGCAACCCGACATTCAAAGCATTCTTGCAGCGCTAGCTTCTCAGCGTCCACCTCATTCTGGCCCG
ACTCAAACACCTCCTGGCCTCCCGGGCCATGGCTATCCCGGGCCAGCCCCGTCTTCGCAGTCAGCTGGTTACCAG
CCGCCGCCCCCTAACACCGGCGCACCTCCCTATGGTGCCCCTGTTCATGGTCTGCCTGCGCCTGCTGTCAGCGGA
AATGTTGATCTGAGTGCCATTCGACCCGTGACATCGGGCACCATGAACTTCGACGATGCTGGTTCCAAGGCAAGG
CCATTCGCCTCCGACAAGGCTCCTGCGCCCCCGGATCGGCCGCTCGGGTATGGCGGTGATGCCAGAAACAACGAT
CGATCATATCGAAGATCAAGATCCCGCTCCCCGAGAGCCGAATTCAATCGGGATGAGCGCGGTGGAGGACACTAC
GGACGCGATCGCTCTTATTCACCCCCTCCTCGTGGCCGGACATTCTCCCCCCGTGGAGGCAATGGCCGGCAAAGA
TCCCCGCTGCGAGGTGCCGACGACAACTCGGAGACGATACAGATAGAGTCTAGCCTGGTTGGTTTGATTATTGGT
CGACAAGGCGAGAATCTCCGCCGAATAGAGACGGACTCAAAATGTCGCGTTCAGTTCCTGGCAGCCTCCGATGGT
GTTCCTTTCCGGCAATGCAGAATCTCGGGTCCGCGCCAACGCCGCGCCGAGGTGAAAGCTGCCATCAACCGCATC
ATCGACGACAGCGGAATGGGCGCCTTGAATCGGCCGCAGGACAAGTCGAGAGATGCGGCCCGTGTCACCGGGTCG
ACGTCACTGCGAGACGGCGAGGATCATATGCAGATCATGGTTCCGGATCGAACGGTGGGACTCATCATAGGCCGT
GGCGGTGAAACGATCCGCGATCTACAGGAACGATCGGGTTGTCACATTAATATCGTTGGAGAGTCAAAGAGCGTT
AACGGTTTGCGGCCAGTGAATCTGATAGGGACGGTTGAGGCTGCGGCCCGAGCCAAGGATTTCATCATGGAGATT
GTCGACAGTGACACTCGAGGCGACGGTCCCGCAGTGAAGAAACCTCCCGTCGCCAGCCGAGCTGAGGCGCCGCCA
AGGGACATGGGCGGAGGCGCGCAGGACAAGGCCAACGACGTCATCTACGTCCCGTCCGATGCAGTAGGCATGATC
ATCGGCAAGGGAGGCGAGACCATACGGGATATGCAGAACAGCACTGGGTGCAAGATCAACGTGGCACAATCGTCC
GGGCCTGGTGAGGTGCAGCGAGAGATTGCTTTGATCGGCTCGCGAGATAGTATCGTTCGAGCGAAGCAGGCCATC
GACGAGAAGGTGGATGCCGTGAGATCAAAGAGCGGCGGCGGCGGAGTTGGAGTTGGAGGAGGAGGAGGAGGAGGA
GGAGGAGGAGGAGGAGGAGGAGGAGGCGGCCGGAGCCGTGGCCAGCCCGACATGGAACGGGCTGCCTACTCGCAG
CAGTCATCGACTAACCAAGCGCCGGCAGCTGCAGGCGACGCGTCCGACCCCTACGCCCAATATGGCGGATACCAA
AACTACGTGGCGCTCTGGTACCAATCGCTGATGTACCAGCAGCAGCAGCAGCAACAGGGCGGACAAGGAGCGTCG
ACCGGAGCATCGGCTGGAGCGCCGGCGCCGGGAGCTCAGTGA
Gene >Ophcf2|04316
ATGGCTGAACCGCAACCCGACATTCAAAGCATTCTTGCAGCGCTAGGTGAGATCCCCCAGCTTCCCGTTCCCGAA
TTCGTACTTGAGCTGAATGTCATTCGCGCAGCTTCTCAGCGTCCACCTCATTCTGGCCCGACTCAAACACCTCCT
GGCCTCCCGGGCCATGGCTATCCCGGGCCAGCCCCGTCTTCGCAGTCAGCTGGTTACCAGCCGCCGCCCCCTAAC
ACCGGCGCACCTCCCTATGGTGCCCCTGTTCATGGTCTGCCTGCGCCTGCTGTCAGCGGAAATGTTGATCTGAGT
GCCATTCGACCCGTGACATCGGGCACCATGAACTTCGACGATGCTGGTTCCAAGGCAAGGCCATTCGCCTCCGAC
AAGGCTCCTGCGCCCCCGGATCGGCCGCTCGGGTATGGCGGTGATGCCAGAAACAACGATCGATCATATCGAAGA
TCAAGATCCCGCTCCCCGAGAGCCGAATTCAATCGGGATGAGCGCGGTGGAGGACACTACGGACGCGATCGCTCT
TATTCACCCCCTCCTCGTGGCCGGACATTCTCCCCCCGTGGAGGCAATGGCCGGCAAAGATCCCCGCTGCGAGGT
GCCGACGACAACTCGGAGACGATACAGATAGAGTCTAGCCTGGTTGGTTTGATTATTGGTCGACAAGGCGAGAAT
CTCCGCCGAATAGAGACGGACTCAAAATGTCGCGTTCAGTTCCTGGCAGCCTCCGATGGTGTTCCTTTCCGGCAA
TGCAGAATCTCGGGTCCGCGCCAACGCCGCGCCGAGGTGAAAGCTGCCATCAACCGCATCATCGACGACAGCGGA
ATGGGCGCCTTGAATCGGCCGCAGGACAAGTCGAGAGATGCGGCCCGTGTCACCGGGTCGACGTCACTGCGAGAC
GGCGAGGATCATATGCAGATCATGGTTCCGGATCGAACGGTGGGACTCATCATAGGCCGTGGCGGTGAAACGATC
CGCGATCTACAGGAACGATCGGGTTGTCACATTAATATCGTTGGAGAGTCAAAGAGCGTTAACGGTTTGCGGCCA
GTGAATCTGATAGGGACGGTTGAGGCTGCGGCCCGAGCCAAGGATTTCATCATGGAGATTGTCGACAGTGACACT
CGAGGCGACGGTCCCGCAGTGAAGAAACCTCCCGTCGCCAGCCGAGCTGAGGCGCCGCCAAGGGACATGGGCGGA
GGCGCGCAGGACAAGGCCAACGACGTCATCTACGTCCCGTCCGATGCAGTAGGCATGATCATCGGCAAGGGAGGC
GAGACCATACGGGATATGCAGAACAGCACTGGGTGCAAGATCAACGTGGCACAATCGTCCGGGCCTGGTGAGGTG
CAGCGAGAGATTGCTTTGATCGGCTCGCGAGATAGTATCGTTCGAGCGAAGCAGGCCATCGACGAGAAGGTGGAT
GCCGTGGTACGTTGTCTCACTCTCCATGAACTTTGAACCTTGCTAACGACGACATTGCAGAGATCAAAGAGCGGC
GGCGGCGGAGTTGGAGTTGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGCGGCCGGAGC
CGTGGCCAGCCCGACATGGAACGGGCTGCCTACTCGCAGCAGTCATCGACTAACCAAGCGCCGGCAGCTGCAGGC
GACGCGTCCGACCCCTACGCCCAATGTGAGTCCCCCCTAGCTGCTGATGGAGATGCCCTACTTCGAGCTAACGGA
TCGTCGCAGATGGCGGATACCAAAACTACGTGGCGCTCTGGTACCAATCGCTGATGTACCAGCAGCAGCAGCAGC
AACAGGGCGGACAAGGAGCGTCGACCGGAGCATCGGCTGGAGCGCCGGCGCCGGGAGCTCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail