Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04314
Gene name
Locationscaffold_04:2906243..2907679
Strand-
Gene length (bp)1436
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 2.0E-31 110 432

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1338 0.0628 0.8758 0.0894 0.0985 0.0504 0.2036 0.3499 0.1508 0.0043

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999541

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4901
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3971
Ophiocordyceps australis map64 (Brazil) OphauB2|2540
Ophiocordyceps camponoti-floridani Ophcf2|04314 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4958
Ophiocordyceps kimflemingae Ophio5|1155
Ophiocordyceps subramaniannii Hirsu2|1353

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04314
MKVARSLLALVGGCLGLCRASAVDFSQPMHGLKLQQIKATRAATTDRTASHFSRLQHISNSEHPSTLSRALAVRA
PPSRHDNVYQNITRAGIYSTQYAIDCSWDGTPTWLLLDTGSADTWSVRSDYYCDDGLGGTVGCGFGWPLIEDFGG
GSIPDLHFSLRYGSGERVRGPMGFSDIVCGGLLVTKQQVGLANYTYWHGNNLTVGILGLAYPSITSAYYGDIGAE
APWNAISYTPFLTSAILQGAMDPVFSVALIKNSTDGLIAWGGLPPVDWRQGKTATTDLIIANLIDQAETSWRYSF
YTIIPDGIRWGQTTDSTKFPYIVDTGTTMNYLPPPLAEAIANAFQPRAVYLYQWGSYFAPCHSVPPPVSVVISGV
EFSINAADMIYQDLRDPLTGYCAVAIASGGTGPYILGDVFLQNVVAVFDVGAAQMRFYSR*
Coding >Ophcf2|04314
ATGAAGGTGGCTCGGTCTCTGCTGGCTCTGGTGGGAGGATGCTTAGGCCTGTGCCGGGCCTCGGCGGTCGACTTC
TCGCAGCCCATGCACGGGCTCAAGCTGCAGCAGATCAAGGCGACGCGAGCGGCGACTACGGACCGGACGGCGTCG
CATTTCTCGCGGCTTCAGCATATCAGCAACAGCGAGCATCCATCGACGCTTAGCCGGGCTCTCGCGGTGAGGGCG
CCTCCTTCGCGGCACGACAACGTGTACCAGAATATCACGCGGGCCGGCATCTACTCGACGCAGTATGCCATCGAC
TGCAGCTGGGATGGGACGCCCACGTGGTTGCTGCTCGACACGGGGAGCGCCGATACGTGGTCGGTGCGGTCCGAC
TACTACTGTGACGACGGGCTCGGGGGCACCGTTGGCTGCGGCTTCGGCTGGCCGCTCATCGAGGACTTTGGCGGA
GGTTCCATCCCCGACCTACACTTTTCGCTACGATACGGCTCCGGCGAGAGGGTCAGGGGGCCGATGGGATTCAGC
GACATTGTCTGCGGAGGGCTGCTGGTGACGAAGCAGCAGGTCGGACTGGCCAACTACACGTACTGGCACGGCAAT
AACCTGACGGTCGGGATCCTTGGGCTGGCGTATCCGTCCATCACGAGCGCCTACTACGGGGACATTGGGGCCGAG
GCACCGTGGAACGCCATCTCGTACACGCCGTTTTTGACGAGTGCCATCTTGCAGGGAGCTATGGATCCGGTCTTC
AGCGTTGCGCTCATTAAGAATTCGACGGATGGCCTTATTGCTTGGGGGGGTTTACCGCCGGTGGACTGGCGGCAG
GGAAAGACGGCGACGACGGATCTGATTATCGCCAACCTCATCGATCAGGCTGAGACGTCGTGGAGATACTCATTC
TACACCATTATCCCGGACGGCATCAGATGGGGTCAGACGACGGACTCGACCAAGTTTCCGTACATTGTGGACACG
GGCACGACGATGAACTATCTGCCTCCGCCCCTGGCTGAAGCCATCGCCAACGCCTTTCAGCCGCGAGCCGTGTAC
CTATACCAATGGGGCTCGTACTTTGCGCCGTGCCACTCGGTGCCGCCGCCGGTGTCGGTGGTGATTTCTGGCGTC
GAGTTTAGCATCAACGCGGCGGATATGATATATCAGGACCTGAGGGATCCCTTGACGGGTTACTGTGCCGTGGCC
ATTGCCAGCGGCGGGACCGGGCCGTATATCCTGGGAGATGTGTTTCTGCAGAACGTGGTGGCGGTGTTTGATGTT
GGGGCGGCGCAGATGCGGTTCTACTCGCGGTGA
Transcript >Ophcf2|04314
ATGAAGGTGGCTCGGTCTCTGCTGGCTCTGGTGGGAGGATGCTTAGGCCTGTGCCGGGCCTCGGCGGTCGACTTC
TCGCAGCCCATGCACGGGCTCAAGCTGCAGCAGATCAAGGCGACGCGAGCGGCGACTACGGACCGGACGGCGTCG
CATTTCTCGCGGCTTCAGCATATCAGCAACAGCGAGCATCCATCGACGCTTAGCCGGGCTCTCGCGGTGAGGGCG
CCTCCTTCGCGGCACGACAACGTGTACCAGAATATCACGCGGGCCGGCATCTACTCGACGCAGTATGCCATCGAC
TGCAGCTGGGATGGGACGCCCACGTGGTTGCTGCTCGACACGGGGAGCGCCGATACGTGGTCGGTGCGGTCCGAC
TACTACTGTGACGACGGGCTCGGGGGCACCGTTGGCTGCGGCTTCGGCTGGCCGCTCATCGAGGACTTTGGCGGA
GGTTCCATCCCCGACCTACACTTTTCGCTACGATACGGCTCCGGCGAGAGGGTCAGGGGGCCGATGGGATTCAGC
GACATTGTCTGCGGAGGGCTGCTGGTGACGAAGCAGCAGGTCGGACTGGCCAACTACACGTACTGGCACGGCAAT
AACCTGACGGTCGGGATCCTTGGGCTGGCGTATCCGTCCATCACGAGCGCCTACTACGGGGACATTGGGGCCGAG
GCACCGTGGAACGCCATCTCGTACACGCCGTTTTTGACGAGTGCCATCTTGCAGGGAGCTATGGATCCGGTCTTC
AGCGTTGCGCTCATTAAGAATTCGACGGATGGCCTTATTGCTTGGGGGGGTTTACCGCCGGTGGACTGGCGGCAG
GGAAAGACGGCGACGACGGATCTGATTATCGCCAACCTCATCGATCAGGCTGAGACGTCGTGGAGATACTCATTC
TACACCATTATCCCGGACGGCATCAGATGGGGTCAGACGACGGACTCGACCAAGTTTCCGTACATTGTGGACACG
GGCACGACGATGAACTATCTGCCTCCGCCCCTGGCTGAAGCCATCGCCAACGCCTTTCAGCCGCGAGCCGTGTAC
CTATACCAATGGGGCTCGTACTTTGCGCCGTGCCACTCGGTGCCGCCGCCGGTGTCGGTGGTGATTTCTGGCGTC
GAGTTTAGCATCAACGCGGCGGATATGATATATCAGGACCTGAGGGATCCCTTGACGGGTTACTGTGCCGTGGCC
ATTGCCAGCGGCGGGACCGGGCCGTATATCCTGGGAGATGTGTTTCTGCAGAACGTGGTGGCGGTGTTTGATGTT
GGGGCGGCGCAGATGCGGTTCTACTCGCGGTGA
Gene >Ophcf2|04314
ATGAAGGTGGCTCGGTCTCTGCTGGCTCTGGTGGGAGGATGCTTAGGCCTGTGCCGGGCCTCGGCGGTCGACTTC
TCGCAGCCCATGCACGGGCTCAAGCTGCAGCAGATCAAGGCGACGCGAGCGGCGACTACGGACCGGACGGCGTCG
CATTTCTCGCGGCTTCAGCATATCAGCAACAGCGAGCATCCATCGACGCTTAGCCGGGCTCTCGCGGTGAGGGCG
CCTCCTTCGCGGCACGACAACGTGTACCAGAATATCACGCGGGCCGGCATCTACTCGACGCAGTATGCCATCGAC
TGCAGCTGGGATGGGACGCCCACGTGGTTGCTGCTCGACACGGGGAGCGCCGATACGTGGTCGGTGCGGTCCGAC
TACTACTGTGACGACGGGCTCGGGGGCACCGTTGGCTGCGGCTTCGGCTGGCCGCTCATCGAGGACTTTGGCGGA
GGTTCCATCCCCGACCTACACTTTTCGCTACGATACGGCTCCGGCGAGAGGGTCAGGGGGCCGATGGGATTCAGC
GACATTGTCTGCGGAGGGCTGCTGGTGACGAAGCAGCAGGTCGGACTGGCCAACTACACGTACTGGCACGGCAAT
AACCTGACGGTCGGGATCCTTGGGCTGGCGTATCCGTCCATCACGAGCGCCTACTACGGGGACATTGGGGCCGAG
GCACCGTGGAACGCCATCTCGTACACGCCGTTTTTGACGAGTGCCATCTTGCAGGGAGCTATGGATCCGGTCTTC
AGCGTTGCGCTCATTAAGAATTCGACGGATGGCCTTATTGCTTGGGGGGGTTTACCGCCGGTGGACTGGCGGCAG
GGAAAGACGGCGACGACGGATCTGATTATCGTCAGTTGAGAGCGGGATTCGTATCGGGTATGAGCTGACTGGGGC
GGCAGGCCAACCTCATCGATCAGGCTGAGACGTCGTGGAGATACTCATTCTACACCATTATCCCGGACGGCATCA
GATGGGGTCAGACGACGGACTCGACCAAGTTTCCGTACATTGTGGACACGGGCACGACGATGAACTATCTGCCTC
CGCGTGGGTTTCCCCTGATGTGGCCGATGTGGGAGGGAGAGATACGAGAGAGAGAGGACGCGGCTAACAGTGGAC
GAACAGCCCTGGCTGAAGCCATCGCCAACGCCTTTCAGCCGCGAGCCGTGTACCTATACCAATGGGGCTCGTACT
TTGCGCCGTGCCACTCGGTGCCGCCGCCGGTGTCGGTGGTGATTTCTGGCGTCGAGTTTAGCATCAACGCGGCGG
ATATGATATATCAGGACCTGAGGGATCCCTTGACGGGTTACTGTGCCGTGGCCATTGCCAGCGGCGGGACCGGGC
CGTATATCCTGGGAGATGTGTTTCTGCAGAACGTGGTGGCGGTGTTTGATGTTGGGGCGGCGCAGATGCGGTTCT
ACTCGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail