Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04312
Gene name
Locationscaffold_04:2898681..2901244
Strand+
Gene length (bp)2563
Transcript length (bp)2247
Coding sequence length (bp)2247
Protein length (aa) 749

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01803 LIM_bind LIM-domain binding protein 3.3E-71 368 615

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2804 0.9252 0.0426 0.0338 0.0215 0.0008 0.0716 0.0167 0.0209 0.0007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1470
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7488
Ophiocordyceps australis map64 (Brazil) OphauB2|2537
Ophiocordyceps camponoti-floridani Ophcf2|04312 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|176
Ophiocordyceps kimflemingae Ophio5|1152
Ophiocordyceps subramaniannii Hirsu2|11055

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04312
MGPNFTGHPAGMPHQSVAGHPLGPGMPPNPGQQGGPGGGMPQQYGGGHMGVTGPGGQVNPALMGQLPPGLGPHNL
QHLTAAQQQQLFQQQQHHHQQHLQSQFNNPSAMVAMRQQQLLQHQQQQARQALIAQQGMHNMGVSNGLPMSMQIS
HQQMQQLRNAGRLGQNPQAQAVMAQQLALQQAQQVAHGQGMPGGPGQAQHMQMGGPGMAAVQQQLPGQGHMTGAG
GGGGGQNQMGGQQQPGGQQAPLHPQSQPPGQPQQTPQQAQQTPQQSSQAGTPAPSGQQTPSQTPAPTPAQASQLQ
QSQAHAQAQAQAQAQAQAHAHAQAQAQAQAQHMNMAGQQHMATAHQLAMSSGFLQQQRRDGSKGQCLLRLLQFSE
HLSSYPGPKGKDDLSYWNMFVARFFSPAGVFRQSLHISDAEDTTDKQYEIAYPAIARYFHTHFGSGVKSMQLFMD
KGGADRPLPGDGYCIENARSSIVYWYETGSHLVATGNLRVHFDAEQRIELFEFLTTAHEEYVSRKIVIDAAKPAH
MWLKEWHKANSQDAKLSPEMSKKSKAKLLRSPQTQPPELLADLPDCAVNSKGVTEAVHQFLEIVEVMGQMNPLIG
FCHGNPGMGPYAALDQYVSTFISGGPPAMNGAQQGPRTPSFGQFGMGTSPAAAHMNLPVSPHMGSPAPGHMQAPG
MQLQASQQGTSSSGPSANTSPASNKRRRPSGIKEEEGSGAPTPVGSVPQINGAPSRPSKPPTPRIPKRVKGNP*
Coding >Ophcf2|04312
ATGGGACCCAACTTCACCGGGCATCCTGCCGGCATGCCTCACCAGTCCGTCGCCGGTCATCCCTTGGGGCCCGGC
ATGCCCCCCAACCCCGGTCAACAAGGCGGGCCCGGCGGCGGCATGCCACAGCAGTATGGAGGCGGCCACATGGGC
GTGACCGGTCCTGGGGGTCAGGTCAATCCGGCCCTCATGGGTCAGTTACCGCCGGGCCTCGGCCCGCATAACCTG
CAGCACTTGACGGCTGCTCAGCAGCAACAGCTGTTCCAGCAGCAGCAACACCATCATCAGCAGCATTTGCAGAGC
CAGTTCAACAACCCCAGCGCCATGGTGGCGATGCGGCAGCAACAGCTGCTACAACACCAACAACAGCAGGCCAGA
CAGGCTCTGATAGCCCAGCAGGGCATGCACAATATGGGCGTCAGCAACGGCCTGCCCATGAGCATGCAGATAAGT
CATCAGCAGATGCAGCAGCTCCGGAACGCCGGCAGGCTTGGACAGAATCCTCAGGCTCAGGCCGTAATGGCCCAG
CAACTCGCCCTGCAGCAGGCGCAACAAGTAGCGCACGGCCAGGGCATGCCCGGCGGTCCAGGCCAGGCACAGCAC
ATGCAGATGGGCGGCCCGGGCATGGCGGCGGTGCAGCAGCAGCTGCCGGGCCAAGGCCACATGACAGGCGCTGGC
GGCGGAGGGGGCGGCCAGAACCAGATGGGCGGACAGCAACAACCGGGCGGACAACAGGCGCCACTCCACCCCCAG
TCACAGCCCCCAGGCCAGCCTCAGCAGACGCCGCAGCAGGCCCAGCAGACGCCTCAACAGAGCTCACAGGCCGGG
ACGCCAGCTCCAAGCGGCCAGCAGACGCCGTCGCAAACGCCCGCCCCGACGCCGGCACAGGCGAGCCAGCTTCAA
CAGAGCCAGGCTCATGCCCAGGCTCAGGCTCAGGCTCAGGCTCAGGCTCAGGCTCATGCTCATGCTCAGGCTCAG
GCCCAGGCTCAGGCGCAACACATGAACATGGCGGGGCAGCAGCATATGGCGACGGCTCACCAGCTGGCCATGTCG
AGCGGCTTCCTGCAGCAGCAGAGGAGGGACGGGTCCAAGGGGCAGTGCCTGCTGAGGCTGCTCCAGTTTAGCGAG
CACCTCAGCAGCTATCCCGGTCCCAAGGGCAAGGATGACCTCTCGTACTGGAACATGTTTGTCGCCCGCTTCTTC
TCTCCCGCGGGCGTCTTCCGACAGTCGCTCCATATCAGCGACGCCGAGGACACGACGGACAAGCAGTACGAGATC
GCCTACCCTGCCATCGCGCGCTACTTCCACACGCACTTTGGGAGCGGCGTCAAGAGCATGCAGCTGTTCATGGAC
AAGGGAGGAGCGGACCGACCGCTACCGGGAGACGGCTACTGCATCGAGAACGCTCGGTCCAGCATCGTTTACTGG
TACGAGACGGGGTCGCACCTGGTGGCGACGGGCAACCTGCGGGTGCACTTTGACGCTGAGCAGCGGATCGAGCTG
TTTGAGTTCCTGACGACGGCTCACGAGGAATACGTCTCGCGCAAGATCGTCATCGACGCGGCCAAGCCGGCGCAC
ATGTGGCTTAAGGAGTGGCACAAGGCCAACTCTCAGGACGCCAAGCTGTCGCCCGAGATGTCCAAGAAGTCCAAG
GCGAAGCTGCTCCGATCGCCGCAGACGCAGCCGCCGGAGCTGCTGGCGGATCTGCCGGACTGCGCCGTCAACAGC
AAGGGGGTGACGGAGGCGGTGCACCAGTTTCTCGAGATTGTCGAGGTCATGGGCCAGATGAACCCCCTGATCGGC
TTCTGCCACGGCAACCCGGGAATGGGCCCCTACGCGGCTCTGGACCAGTACGTGTCGACGTTCATCAGCGGCGGT
CCGCCGGCCATGAACGGGGCGCAGCAGGGGCCGAGGACGCCGAGCTTCGGCCAGTTCGGCATGGGAACGAGCCCG
GCGGCGGCACACATGAACCTACCGGTCTCTCCCCACATGGGCAGTCCGGCTCCGGGCCACATGCAGGCTCCCGGC
ATGCAGCTGCAGGCGAGCCAGCAGGGGACGAGTTCCAGCGGGCCGAGCGCCAACACGTCGCCGGCTTCCAACAAG
CGGAGGCGACCCTCGGGCATCAAGGAGGAGGAAGGATCGGGGGCGCCGACGCCGGTCGGGTCGGTGCCGCAGATC
AACGGAGCTCCGAGCCGGCCCAGCAAGCCGCCGACGCCGCGGATCCCGAAGAGGGTCAAGGGCAATCCATAG
Transcript >Ophcf2|04312
ATGGGACCCAACTTCACCGGGCATCCTGCCGGCATGCCTCACCAGTCCGTCGCCGGTCATCCCTTGGGGCCCGGC
ATGCCCCCCAACCCCGGTCAACAAGGCGGGCCCGGCGGCGGCATGCCACAGCAGTATGGAGGCGGCCACATGGGC
GTGACCGGTCCTGGGGGTCAGGTCAATCCGGCCCTCATGGGTCAGTTACCGCCGGGCCTCGGCCCGCATAACCTG
CAGCACTTGACGGCTGCTCAGCAGCAACAGCTGTTCCAGCAGCAGCAACACCATCATCAGCAGCATTTGCAGAGC
CAGTTCAACAACCCCAGCGCCATGGTGGCGATGCGGCAGCAACAGCTGCTACAACACCAACAACAGCAGGCCAGA
CAGGCTCTGATAGCCCAGCAGGGCATGCACAATATGGGCGTCAGCAACGGCCTGCCCATGAGCATGCAGATAAGT
CATCAGCAGATGCAGCAGCTCCGGAACGCCGGCAGGCTTGGACAGAATCCTCAGGCTCAGGCCGTAATGGCCCAG
CAACTCGCCCTGCAGCAGGCGCAACAAGTAGCGCACGGCCAGGGCATGCCCGGCGGTCCAGGCCAGGCACAGCAC
ATGCAGATGGGCGGCCCGGGCATGGCGGCGGTGCAGCAGCAGCTGCCGGGCCAAGGCCACATGACAGGCGCTGGC
GGCGGAGGGGGCGGCCAGAACCAGATGGGCGGACAGCAACAACCGGGCGGACAACAGGCGCCACTCCACCCCCAG
TCACAGCCCCCAGGCCAGCCTCAGCAGACGCCGCAGCAGGCCCAGCAGACGCCTCAACAGAGCTCACAGGCCGGG
ACGCCAGCTCCAAGCGGCCAGCAGACGCCGTCGCAAACGCCCGCCCCGACGCCGGCACAGGCGAGCCAGCTTCAA
CAGAGCCAGGCTCATGCCCAGGCTCAGGCTCAGGCTCAGGCTCAGGCTCAGGCTCATGCTCATGCTCAGGCTCAG
GCCCAGGCTCAGGCGCAACACATGAACATGGCGGGGCAGCAGCATATGGCGACGGCTCACCAGCTGGCCATGTCG
AGCGGCTTCCTGCAGCAGCAGAGGAGGGACGGGTCCAAGGGGCAGTGCCTGCTGAGGCTGCTCCAGTTTAGCGAG
CACCTCAGCAGCTATCCCGGTCCCAAGGGCAAGGATGACCTCTCGTACTGGAACATGTTTGTCGCCCGCTTCTTC
TCTCCCGCGGGCGTCTTCCGACAGTCGCTCCATATCAGCGACGCCGAGGACACGACGGACAAGCAGTACGAGATC
GCCTACCCTGCCATCGCGCGCTACTTCCACACGCACTTTGGGAGCGGCGTCAAGAGCATGCAGCTGTTCATGGAC
AAGGGAGGAGCGGACCGACCGCTACCGGGAGACGGCTACTGCATCGAGAACGCTCGGTCCAGCATCGTTTACTGG
TACGAGACGGGGTCGCACCTGGTGGCGACGGGCAACCTGCGGGTGCACTTTGACGCTGAGCAGCGGATCGAGCTG
TTTGAGTTCCTGACGACGGCTCACGAGGAATACGTCTCGCGCAAGATCGTCATCGACGCGGCCAAGCCGGCGCAC
ATGTGGCTTAAGGAGTGGCACAAGGCCAACTCTCAGGACGCCAAGCTGTCGCCCGAGATGTCCAAGAAGTCCAAG
GCGAAGCTGCTCCGATCGCCGCAGACGCAGCCGCCGGAGCTGCTGGCGGATCTGCCGGACTGCGCCGTCAACAGC
AAGGGGGTGACGGAGGCGGTGCACCAGTTTCTCGAGATTGTCGAGGTCATGGGCCAGATGAACCCCCTGATCGGC
TTCTGCCACGGCAACCCGGGAATGGGCCCCTACGCGGCTCTGGACCAGTACGTGTCGACGTTCATCAGCGGCGGT
CCGCCGGCCATGAACGGGGCGCAGCAGGGGCCGAGGACGCCGAGCTTCGGCCAGTTCGGCATGGGAACGAGCCCG
GCGGCGGCACACATGAACCTACCGGTCTCTCCCCACATGGGCAGTCCGGCTCCGGGCCACATGCAGGCTCCCGGC
ATGCAGCTGCAGGCGAGCCAGCAGGGGACGAGTTCCAGCGGGCCGAGCGCCAACACGTCGCCGGCTTCCAACAAG
CGGAGGCGACCCTCGGGCATCAAGGAGGAGGAAGGATCGGGGGCGCCGACGCCGGTCGGGTCGGTGCCGCAGATC
AACGGAGCTCCGAGCCGGCCCAGCAAGCCGCCGACGCCGCGGATCCCGAAGAGGGTCAAGGGCAATCCATAG
Gene >Ophcf2|04312
ATGGGACCCAACTTCACCGGGCATCCTGCCGGCATGCCTCACCAGTCCGTCGCCGGTCATCCCTTGGGGCCCGGC
ATGCCCCCCAACCCCGGTCAACAAGGCGGGCCCGGCGGCGGCATGCCACAGCAGTATGGAGGCGGCCACATGGGC
GTGACCGGTCCTGGGGGTCAGGTCAATCCGGCCCTCATGGGTCAGTTACCGCCGGGCCTCGGCCCGCATAACCTG
CAGCACTTGACGGCTGCTCAGCAGCAACAGCTGTTCCAGCAGCAGCAACACCATCATCAGCAGCATTTGCAGAGC
CAGTGTATGCCACCCTCATCCCCATGCTCATCTTCGTCTCCAAGCTCGCTAACCTTGAGGCCTTTGCAGTCAACA
ACCCCAGCGCCATGGTGGCGATGCGGCAGCAACAGCTGCTACAACACCAACAACAGCAGGCCAGACAGGCTCTGA
TAGCCCAGCAGGGCATGCACAATATGGGCGTCAGCAACGGCCTGCCCATGAGCATGCAGATAAGTCATCAGCAGA
TGCAGCAGCTCCGGAACGCCGGCAGGCTTGGACAGGTGAGGACGTTTGCTCGCAAGGCGTCGACGACGGTTGGCT
GACTGGTCCGCGACCACCTACCTAGAATCCTCAGGCTCAGGCCGTAATGGCCCAGCAACTCGCCCTGCAGCAGGC
GCAACAAGTAGCGCACGGCCAGGGCATGCCCGGCGGTCCAGGCCAGGCACAGCACATGCAGATGGGCGGCCCGGG
CATGGCGGCGGTGCAGCAGCAGCTGCCGGGCCAAGGCCACATGACAGGCGCTGGCGGCGGAGGGGGCGGCCAGAA
CCAGATGGGCGGACAGCAACAACCGGGCGGACAACAGGCGCCACTCCACCCCCAGTCACAGCCCCCAGGCCAGCC
TCAGCAGACGCCGCAGCAGGCCCAGCAGACGCCTCAACAGAGCTCACAGGCCGGGACGCCAGCTCCAAGCGGCCA
GCAGACGCCGTCGCAAACGCCCGCCCCGACGCCGGCACAGGCGAGCCAGCTTCAACAGAGCCAGGCTCATGCCCA
GGCTCAGGCTCAGGCTCAGGCTCAGGCTCAGGCTCATGCTCATGCTCAGGCTCAGGCCCAGGCTCAGGCGCAACA
CATGAACATGGCGGGGCAGCAGCATATGGCGACGGCTCACCAGCTGGCCATGTCGAGCGGCTTCCTGCAGCAGCA
GAGGAGGGACGGGTCCAAGGGGCAGTGCCTGCTGAGGCTGCTCCAGTTTAGCGAGCACCTCAGCAGCTATCCCGT
AAGTCGAGGCCCCTTCCATGGCATGGCTGGGAGGGAGGGGAGACCAGAACTGACTCGCGATAGGGTCCCAAGGGC
AAGGATGACCTCTCGTACTGGAACATGTTTGTCGCCCGCTTCTTCTCTCCCGCGGGCGTCTTCCGACAGTCGCTC
CATATCAGCGACGCCGAGGACACGACGGACAAGCAGTACGAGATCGCCTACCCTGCCATCGCGCGCTACTTCCAC
ACGCACTTTGGGAGCGGCGTCAAGAGCATGCAGCTGTTCATGGACAAGGGAGGAGCGGACCGACCGCTACCGGGA
GACGGCTACTGCATCGAGAACGCTCGGTCCAGCATCGTTTACTGGTACGAGACGGGGTCGCACGTGAGTCTTGGG
ATATCCGGAGCGTCTGGAAGAGAGAGCAGCGGCTGACCAAGGCATCAAACAGCTGGTGGCGACGGGCAACCTGCG
GGTGCACTTTGACGCTGAGCAGCGGATCGAGCTGTTTGAGTTCCTGACGACGGCTCACGAGGAATACGTCTCGCG
CAAGATCGTCATCGACGCGGCCAAGCCGGCGCACATGTGGCTTAAGGAGTGGCACAAGGCCAACTCTCAGGACGC
CAAGCTGTCGCCCGAGATGTCCAAGAAGTCCAAGGCGAAGCTGCTCCGATCGCCGCAGACGCAGCCGCCGGAGCT
GCTGGCGGATCTGCCGGACTGCGCCGTCAACAGCAAGGGGGTGACGGAGGCGGTGCACCAGTTTCTCGAGGTGGG
TGTTTTCCGACGAGAACGATGACGATGATGACGTCGCTGACGAGGCGTGCAGATTGTCGAGGTCATGGGCCAGAT
GAACCCCCTGATCGGCTTCTGCCACGGCAACCCGGGAATGGGCCCCTACGCGGCTCTGGACCAGTACGTGTCGAC
GTTCATCAGCGGCGGTCCGCCGGCCATGAACGGGGCGCAGCAGGGGCCGAGGACGCCGAGCTTCGGCCAGTTCGG
CATGGGAACGAGCCCGGCGGCGGCACACATGAACCTACCGGTCTCTCCCCACATGGGCAGTCCGGCTCCGGGCCA
CATGCAGGCTCCCGGCATGCAGCTGCAGGCGAGCCAGCAGGGGACGAGTTCCAGCGGGCCGAGCGCCAACACGTC
GCCGGCTTCCAACAAGCGGAGGCGACCCTCGGGCATCAAGGAGGAGGAAGGATCGGGGGCGCCGACGCCGGTCGG
GTCGGTGCCGCAGATCAACGGAGCTCCGAGCCGGCCCAGCAAGCCGCCGACGCCGCGGATCCCGAAGAGGGTCAA
GGGCAATCCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail