Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04309
Gene name
Locationscaffold_04:2888544..2891897
Strand+
Gene length (bp)3353
Transcript length (bp)3183
Coding sequence length (bp)3183
Protein length (aa) 1061

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10366 Vps39_1 Vacuolar sorting protein 39 domain 1 2.8E-32 614 720
PF10367 Vps39_2 Vacuolar sorting protein 39 domain 2 7.3E-26 919 1041
PF00780 CNH CNH domain 2.1E-15 86 331

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus|Lysosome/Vacuole Nuclear export signal 0.4248 0.5293 0.0936 0.0245 0.0664 0.0029 0.1703 0.6507 0.3375 0.0413

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1629
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7484
Ophiocordyceps australis map64 (Brazil) OphauB2|2534
Ophiocordyceps camponoti-floridani Ophcf2|04309 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4813
Ophiocordyceps kimflemingae Ophio5|7557
Ophiocordyceps subramaniannii Hirsu2|1302

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04309
MLSAFTARPIIELRPRDKSRIETILAYGDRILVGLNSGALRVYRLNELSTPTDHPPDSQEVQAQHGNESARPAST
KPTDLLREVDKFSSRAIEQLAIIKEANIIISLSNYHVSLHDLQTYDLIGTLSRSRNASCFAVTSNIVKDPDTSIP
EIISRLAVAVKRRLLLWSWHESELHDDVGEIVLSESIRTVTWASATKLVCGMNGGYVMVDSVTHEVEDIVSPGMV
GAGAQGSRFGAVSSAGMGYMGLGGYMPRPLAAKLADDEMLLAKDINTLFIKADGKPLDRRQIPWPSAPESIGFSY
PYILALQPPSKGFLEVRNPDTLSLLQSISLPGAAQLHFPPPTVSLAHAGKGFHISSERCVWKMAATDYDSQVEEL
VDGHSFDEAISVLNMLEDALLKNKKETLREVKMLKAEMLFKKRKHRQAMDLMNEDDVQAPPERVLRLFPPQISGD
LSRWAHQDGDGGDEVVAVKKPNGTVPEGSEGLADHLMMHNPIGGFAKLFRASSKKGPSDAASVASVKKETADEDD
TESAKESSATEDRPLEGKDLVKAVQELNSYLAGTRARLQRVLDPVTGKLKPRSDRQESTEEAAERFLRTTQSESE
QRLETELRATFKLVDTTLFRSYMLSQPSLASSLFRIPNFCDPDVVNEKLLEHNRFTELVDFFYGKRLHKEALQLL
YKFGSATKPDEAAPTLHGPDRSIQYLQSLPPSEMDLILEHAAWTLASNPDYAMEIFVGDTENAETLPRDRVVAFL
QSIDTQLERQYLEHIINELDDMTPDFHNRLVDLYVENLGATSQGPEWDRLMAKFIRFLRSSRQVYSLTKALGLIP
RDDAAFYEARAVVLSNMGEHREALEIYVFRMKDYAKAEEYCNRLYKAKEATRSSVADSPASLAPEDPAKSIYHTL
LSLYLKPPAAHKQQLEPALDLLSKHGSRLPASSTLGLVPDDLPVRALEAYFRGRIRSVNSHVNESRIVAGLRKAE
GISVAARLHLGDDAAGGQGGRNRHVTISDERHCVVCHKKLGGAMRIGGSVVAVLPDNTAVHYGCLNRATGQKADR
LQAPSWARGG*
Coding >Ophcf2|04309
ATGCTATCCGCCTTCACCGCCCGGCCCATCATCGAGCTGCGGCCACGAGACAAATCCCGGATCGAGACCATCCTC
GCATACGGCGATCGCATCCTCGTCGGCCTCAATAGCGGCGCCCTCCGTGTCTATCGGCTCAACGAGCTCTCTACC
CCGACCGACCATCCTCCAGACTCGCAGGAAGTCCAAGCTCAGCATGGGAACGAATCAGCTAGACCGGCCTCGACG
AAGCCGACGGATCTTTTGCGCGAGGTCGACAAGTTTTCGAGCCGCGCCATCGAGCAGCTGGCCATTATCAAGGAA
GCCAACATCATCATATCCCTTTCCAACTACCACGTCTCTCTCCACGACCTGCAGACCTACGACCTCATCGGGACC
CTCAGTCGTTCCCGGAACGCTTCCTGCTTCGCCGTAACCTCCAACATCGTCAAGGACCCCGACACCAGCATACCC
GAAATTATCAGCCGGCTCGCCGTTGCCGTCAAGCGTCGTCTTCTTCTCTGGAGCTGGCACGAAAGCGAGCTTCAC
GACGATGTAGGCGAGATCGTTCTCTCCGAGTCAATTCGGACTGTCACATGGGCCAGCGCGACCAAGCTCGTGTGC
GGCATGAACGGCGGTTACGTCATGGTCGACTCCGTCACCCACGAGGTCGAGGATATCGTCAGCCCCGGCATGGTG
GGTGCTGGCGCTCAGGGTAGCCGCTTCGGTGCCGTCAGTAGCGCCGGCATGGGCTATATGGGGTTGGGGGGATAC
ATGCCGAGGCCGCTCGCCGCCAAGCTGGCCGACGACGAGATGCTCTTGGCCAAGGACATCAACACGCTCTTCATC
AAGGCCGATGGAAAGCCGCTGGATAGGCGTCAAATACCCTGGCCATCCGCTCCAGAGTCCATCGGCTTCTCCTAC
CCCTATATCCTAGCCCTACAGCCGCCGTCCAAGGGCTTCCTCGAGGTTCGCAACCCGGACACCTTGTCCCTTCTC
CAGAGCATCTCGCTCCCCGGCGCCGCTCAGCTTCACTTCCCTCCGCCTACAGTGAGCCTCGCGCACGCGGGCAAG
GGCTTTCACATCTCAAGCGAGCGCTGCGTGTGGAAGATGGCAGCGACGGATTACGACTCGCAGGTGGAGGAGCTT
GTGGATGGTCATTCGTTCGACGAGGCCATTAGCGTACTCAACATGCTCGAAGACGCCCTTCTGAAGAACAAAAAG
GAGACGCTCCGGGAGGTAAAGATGCTCAAGGCCGAGATGCTTTTCAAGAAGAGGAAACATCGGCAGGCAATGGAC
CTGATGAACGAGGACGACGTGCAAGCACCGCCAGAGAGAGTGCTGAGGCTCTTTCCGCCTCAGATATCCGGAGAC
TTGTCCCGTTGGGCTCATCAGGACGGGGACGGGGGTGACGAGGTGGTCGCCGTCAAGAAGCCCAACGGGACAGTC
CCGGAAGGCTCGGAGGGACTGGCAGACCATCTGATGATGCACAATCCCATAGGCGGCTTCGCCAAGCTGTTCAGG
GCCTCTAGTAAGAAGGGCCCCTCAGACGCGGCGTCAGTCGCCTCGGTAAAGAAGGAGACCGCGGACGAGGACGAC
ACGGAGAGCGCCAAGGAGTCGTCTGCCACCGAGGACAGGCCCCTCGAGGGCAAGGATCTAGTCAAGGCGGTTCAG
GAGCTCAACAGCTACCTGGCAGGGACCCGGGCCCGGCTTCAGAGGGTCCTCGATCCGGTGACGGGCAAGCTGAAG
CCCCGGTCGGACAGGCAGGAATCGACGGAAGAAGCGGCCGAGCGGTTCTTGAGAACGACGCAGAGCGAGTCAGAG
CAGAGGCTCGAGACGGAACTTCGCGCCACCTTTAAACTGGTTGACACAACCCTGTTTCGCTCTTACATGCTGTCG
CAACCGTCGTTGGCGAGCTCGCTGTTCCGGATCCCCAACTTTTGCGACCCGGATGTGGTCAACGAGAAGCTACTG
GAACACAACAGGTTCACGGAGCTGGTTGATTTCTTCTACGGCAAGAGGTTGCACAAGGAGGCCCTGCAGCTCCTT
TACAAGTTCGGATCGGCAACGAAGCCGGACGAGGCAGCGCCGACGCTACACGGGCCCGACCGGTCCATCCAGTAT
CTGCAGAGTCTGCCGCCGTCGGAGATGGACCTCATCTTGGAGCACGCCGCCTGGACGCTGGCCAGCAACCCCGAT
TACGCCATGGAGATCTTCGTCGGCGACACCGAGAACGCCGAGACGTTGCCGCGAGACCGGGTCGTGGCCTTTCTT
CAGAGCATCGATACCCAGCTCGAGAGGCAGTATCTGGAGCACATCATCAACGAGCTCGACGACATGACGCCCGAC
TTCCACAACCGTCTGGTGGACTTGTACGTGGAGAACCTCGGGGCCACGAGCCAGGGGCCGGAGTGGGACAGGCTC
ATGGCCAAGTTCATCCGGTTCCTGCGAAGTTCTCGTCAGGTCTACAGCCTGACCAAGGCGCTTGGGCTGATTCCC
AGGGATGATGCGGCGTTCTACGAGGCCCGGGCTGTTGTGCTCAGCAATATGGGGGAGCATAGGGAAGCCCTGGAG
ATTTACGTCTTCAGGATGAAGGACTATGCCAAGGCTGAGGAATATTGCAACCGCTTGTACAAGGCGAAGGAAGCC
ACTCGTTCGTCGGTGGCAGACAGTCCCGCGTCCCTGGCCCCCGAAGATCCGGCCAAGTCCATCTACCACACGCTC
TTGTCGCTGTACCTGAAGCCGCCAGCCGCTCACAAGCAGCAGCTCGAGCCGGCGCTGGATCTCCTGTCGAAGCAC
GGGTCCAGGCTCCCTGCCTCTTCAACCCTCGGCCTGGTGCCTGACGATCTGCCGGTCAGGGCTCTCGAAGCCTAC
TTCCGAGGCCGCATCCGATCAGTGAACAGCCACGTCAACGAGTCCCGGATCGTCGCCGGGTTGCGCAAGGCCGAG
GGCATCTCCGTTGCGGCCCGATTGCATCTCGGCGACGACGCGGCTGGCGGGCAAGGCGGGCGCAATCGCCACGTC
ACCATCAGCGACGAGAGGCACTGCGTCGTCTGTCACAAGAAGCTCGGCGGCGCCATGCGCATCGGCGGAAGCGTC
GTTGCCGTCTTGCCGGACAACACGGCTGTGCATTATGGCTGCCTTAACAGGGCGACCGGGCAGAAAGCGGACAGG
CTGCAGGCGCCAAGCTGGGCAAGGGGCGGTTGA
Transcript >Ophcf2|04309
ATGCTATCCGCCTTCACCGCCCGGCCCATCATCGAGCTGCGGCCACGAGACAAATCCCGGATCGAGACCATCCTC
GCATACGGCGATCGCATCCTCGTCGGCCTCAATAGCGGCGCCCTCCGTGTCTATCGGCTCAACGAGCTCTCTACC
CCGACCGACCATCCTCCAGACTCGCAGGAAGTCCAAGCTCAGCATGGGAACGAATCAGCTAGACCGGCCTCGACG
AAGCCGACGGATCTTTTGCGCGAGGTCGACAAGTTTTCGAGCCGCGCCATCGAGCAGCTGGCCATTATCAAGGAA
GCCAACATCATCATATCCCTTTCCAACTACCACGTCTCTCTCCACGACCTGCAGACCTACGACCTCATCGGGACC
CTCAGTCGTTCCCGGAACGCTTCCTGCTTCGCCGTAACCTCCAACATCGTCAAGGACCCCGACACCAGCATACCC
GAAATTATCAGCCGGCTCGCCGTTGCCGTCAAGCGTCGTCTTCTTCTCTGGAGCTGGCACGAAAGCGAGCTTCAC
GACGATGTAGGCGAGATCGTTCTCTCCGAGTCAATTCGGACTGTCACATGGGCCAGCGCGACCAAGCTCGTGTGC
GGCATGAACGGCGGTTACGTCATGGTCGACTCCGTCACCCACGAGGTCGAGGATATCGTCAGCCCCGGCATGGTG
GGTGCTGGCGCTCAGGGTAGCCGCTTCGGTGCCGTCAGTAGCGCCGGCATGGGCTATATGGGGTTGGGGGGATAC
ATGCCGAGGCCGCTCGCCGCCAAGCTGGCCGACGACGAGATGCTCTTGGCCAAGGACATCAACACGCTCTTCATC
AAGGCCGATGGAAAGCCGCTGGATAGGCGTCAAATACCCTGGCCATCCGCTCCAGAGTCCATCGGCTTCTCCTAC
CCCTATATCCTAGCCCTACAGCCGCCGTCCAAGGGCTTCCTCGAGGTTCGCAACCCGGACACCTTGTCCCTTCTC
CAGAGCATCTCGCTCCCCGGCGCCGCTCAGCTTCACTTCCCTCCGCCTACAGTGAGCCTCGCGCACGCGGGCAAG
GGCTTTCACATCTCAAGCGAGCGCTGCGTGTGGAAGATGGCAGCGACGGATTACGACTCGCAGGTGGAGGAGCTT
GTGGATGGTCATTCGTTCGACGAGGCCATTAGCGTACTCAACATGCTCGAAGACGCCCTTCTGAAGAACAAAAAG
GAGACGCTCCGGGAGGTAAAGATGCTCAAGGCCGAGATGCTTTTCAAGAAGAGGAAACATCGGCAGGCAATGGAC
CTGATGAACGAGGACGACGTGCAAGCACCGCCAGAGAGAGTGCTGAGGCTCTTTCCGCCTCAGATATCCGGAGAC
TTGTCCCGTTGGGCTCATCAGGACGGGGACGGGGGTGACGAGGTGGTCGCCGTCAAGAAGCCCAACGGGACAGTC
CCGGAAGGCTCGGAGGGACTGGCAGACCATCTGATGATGCACAATCCCATAGGCGGCTTCGCCAAGCTGTTCAGG
GCCTCTAGTAAGAAGGGCCCCTCAGACGCGGCGTCAGTCGCCTCGGTAAAGAAGGAGACCGCGGACGAGGACGAC
ACGGAGAGCGCCAAGGAGTCGTCTGCCACCGAGGACAGGCCCCTCGAGGGCAAGGATCTAGTCAAGGCGGTTCAG
GAGCTCAACAGCTACCTGGCAGGGACCCGGGCCCGGCTTCAGAGGGTCCTCGATCCGGTGACGGGCAAGCTGAAG
CCCCGGTCGGACAGGCAGGAATCGACGGAAGAAGCGGCCGAGCGGTTCTTGAGAACGACGCAGAGCGAGTCAGAG
CAGAGGCTCGAGACGGAACTTCGCGCCACCTTTAAACTGGTTGACACAACCCTGTTTCGCTCTTACATGCTGTCG
CAACCGTCGTTGGCGAGCTCGCTGTTCCGGATCCCCAACTTTTGCGACCCGGATGTGGTCAACGAGAAGCTACTG
GAACACAACAGGTTCACGGAGCTGGTTGATTTCTTCTACGGCAAGAGGTTGCACAAGGAGGCCCTGCAGCTCCTT
TACAAGTTCGGATCGGCAACGAAGCCGGACGAGGCAGCGCCGACGCTACACGGGCCCGACCGGTCCATCCAGTAT
CTGCAGAGTCTGCCGCCGTCGGAGATGGACCTCATCTTGGAGCACGCCGCCTGGACGCTGGCCAGCAACCCCGAT
TACGCCATGGAGATCTTCGTCGGCGACACCGAGAACGCCGAGACGTTGCCGCGAGACCGGGTCGTGGCCTTTCTT
CAGAGCATCGATACCCAGCTCGAGAGGCAGTATCTGGAGCACATCATCAACGAGCTCGACGACATGACGCCCGAC
TTCCACAACCGTCTGGTGGACTTGTACGTGGAGAACCTCGGGGCCACGAGCCAGGGGCCGGAGTGGGACAGGCTC
ATGGCCAAGTTCATCCGGTTCCTGCGAAGTTCTCGTCAGGTCTACAGCCTGACCAAGGCGCTTGGGCTGATTCCC
AGGGATGATGCGGCGTTCTACGAGGCCCGGGCTGTTGTGCTCAGCAATATGGGGGAGCATAGGGAAGCCCTGGAG
ATTTACGTCTTCAGGATGAAGGACTATGCCAAGGCTGAGGAATATTGCAACCGCTTGTACAAGGCGAAGGAAGCC
ACTCGTTCGTCGGTGGCAGACAGTCCCGCGTCCCTGGCCCCCGAAGATCCGGCCAAGTCCATCTACCACACGCTC
TTGTCGCTGTACCTGAAGCCGCCAGCCGCTCACAAGCAGCAGCTCGAGCCGGCGCTGGATCTCCTGTCGAAGCAC
GGGTCCAGGCTCCCTGCCTCTTCAACCCTCGGCCTGGTGCCTGACGATCTGCCGGTCAGGGCTCTCGAAGCCTAC
TTCCGAGGCCGCATCCGATCAGTGAACAGCCACGTCAACGAGTCCCGGATCGTCGCCGGGTTGCGCAAGGCCGAG
GGCATCTCCGTTGCGGCCCGATTGCATCTCGGCGACGACGCGGCTGGCGGGCAAGGCGGGCGCAATCGCCACGTC
ACCATCAGCGACGAGAGGCACTGCGTCGTCTGTCACAAGAAGCTCGGCGGCGCCATGCGCATCGGCGGAAGCGTC
GTTGCCGTCTTGCCGGACAACACGGCTGTGCATTATGGCTGCCTTAACAGGGCGACCGGGCAGAAAGCGGACAGG
CTGCAGGCGCCAAGCTGGGCAAGGGGCGGTTGA
Gene >Ophcf2|04309
ATGCTATCCGCCTTCACCGCCCGGCCCATCATCGAGCTGCGGCCACGAGACAAATCCCGGATCGAGACCATCCTC
GCATACGGTATATGGTCTTCTTCTGTGGCTTCTCGCGGGAGAGGATACTAACGAAGCAGTCCCAGGCGATCGCAT
CCTCGTCGGCCTCAATAGCGGCGCCCTCCGTGTCTATCGGCTCAACGAGCTCTCTACCCCGACCGACCATCCTCC
AGACTCGCAGGAAGTCCAAGCTCAGCATGGGAACGAATCAGCTAGACCGGCCTCGACGAAGCCGACGGATCTTTT
GCGCGAGGTCGACAAGTTTTCGAGCCGCGCCATCGAGCAGCTGGCCATTATCAAGGAAGCCAACATCATCATATC
CCTTTCCAACTACCACGTCTCTCTCCACGACCTGCAGACCTACGACCTCATCGGGACCCTCAGTCGTTCCCGGAA
CGCTTCCTGCTTCGCCGTAACCTCCAACATCGTCAAGGACCCCGACACCAGCATACCCGAAATTATCAGCCGGCT
CGCCGTTGCCGTCAAGCGTCGTCTTCTTCTCTGGAGCTGGCACGAAAGCGAGCTTCACGACGATGTAGGCGAGAT
CGTTCTCTCCGAGTCAATTCGGACTGTCACATGGGCCAGCGCGACCAAGCTCGTGTGCGGCATGAACGGCGGTTA
CGTCATGGTCGACTCCGTCACCCACGAGGTCGAGGATATCGTCAGCCCCGGCATGGTGGGTGCTGGCGCTCAGGG
TAGCCGCTTCGGTGCCGTCAGTAGCGCCGGCATGGGCTATATGGGGTTGGGGGGATACATGCCGAGGCCGCTCGC
CGCCAAGCTGGCCGACGACGAGATGCTCTTGGCCAAGGACATCAACACGCTCTTCATCAAGGCCGATGGAAAGCC
GCTGGATAGGCGTCAAATACCCTGGCCATCCGCTCCAGAGTCCATCGGCTTCTCCTACCCCTATATCCTAGCCCT
ACAGCCGCCGTCCAAGGGCTTCCTCGAGGTTCGCAACCCGGACACCTTGTCCCTTCTCCAGAGCATCTCGCTCCC
CGGCGCCGCTCAGCTTCACTTCCCTCCGCCTACAGTGAGCCTCGCGCACGCGGGCAAGGGCTTTCACATCTCAAG
CGAGCGCTGCGTGTGGAAGATGGCAGCGACGGATTACGACTCGCAGGTGGAGGAGCTTGTGGATGGTCATTCGTT
CGACGAGGCCATTAGCGTACTCAACATGCTCGAAGACGCCCTTCTGAAGAACAAAAAGGAGACGCTCCGGGAGGT
AAAGATGCTCAAGGCCGAGATGCTTTTCAAGAAGAGGAAACATCGGCAGGCAATGGACCTGATGAACGAGGACGA
CGTGCAAGCACCGCCAGAGAGAGTGCTGAGGCTCTTTCCGCCTCAGATATCCGGAGACTTGTCCCGTTGGGCTCA
TCAGGACGGGGACGGGGGTGACGAGGTGGTCGCCGTCAAGAAGCCCAACGGGACAGTCCCGGAAGGCTCGGAGGG
ACTGGCAGACCATCTGATGATGCACAATCCCATAGGCGGCTTCGCCAAGCTGTTCAGGGCCTCTAGTAAGAAGGG
CCCCTCAGACGCGGCGTCAGTCGCCTCGGTAAAGAAGGAGACCGCGGACGAGGACGACACGGAGAGCGCCAAGGA
GTCGTCTGCCACCGAGGACAGGCCCCTCGAGGGCAAGGATCTAGTCAAGGCGGTTCAGGAGCTCAACAGCTACCT
GGCAGGGACCCGGGCCCGGCTTCAGAGGGTCCTCGATCCGGTGACGGGCAAGCTGAAGCCCCGGTCGGACAGGCA
GGAATCGACGGAAGAAGCGGCCGAGCGGTTCTTGAGAACGACGCAGAGCGAGTCAGAGCAGAGGCTCGAGACGGA
ACTTCGCGCCACCTTTAAACTGGTTGACACAACCCTGTTTCGCTCTTACATGCTGTCGCAACCGTCGTTGGCGAG
CTCGCTGTTCCGGATCCCCAACTTTTGCGACCCGGATGTGGTCAACGAGAAGCTACTGGAACACAACAGGTTCAC
GGAGCTGGTTGATTTCTTCTACGGCAAGAGGTTGCACAAGGAGGCCCTGCAGCTCCTTTACAAGTTCGGATCGGC
AACGAAGCCGGACGAGGCAGCGCCGACGCTACACGGGCCCGACCGGTCCATCCAGTATCTGCAGAGTCTGCCGCC
GTCGGAGATGGACCTCATCTTGGAGCACGCCGCCTGGACGCTGGCCAGCAACCCCGATTACGCCATGGAGATCTT
CGTCGGCGACACCGAGAACGCCGAGACGTTGCCGCGAGACCGGGTCGTGGCCTTTCTTCAGAGCATCGATACCCA
GCTCGAGAGGCAGTATCTGGAGCACATCATCAACGAGCTCGACGACATGACGCCCGACTTCCACAACCGTCTGGT
GGACTTGTACGTGGAGAACCTCGGGGCCACGAGCCAGGGGCCGGAGTGGGACAGGCTCATGGCCAAGTTCATCCG
GTTCCTGCGAAGTTCTCGTCAGGTCTACAGCCTGACCAAGGCGCTTGGGCTGATTCCCAGGGATGGTGAGTCGGG
CGAGATGAGAGGTCGGGAGCGGCTGAGGAGCGCTGACTCGCTTCAACAGATGCGGCGTTCTACGAGGCCCGGGCT
GTTGTGCTCAGCAATATGGGGGAGCATAGGGAAGCCCTGGAGATTTACGTCTTCAGGATGAAGGACTATGCCAAG
GCTGAGGAGTGAGTAGGGTCCAAGTCCGGAGGAGCTTCTATTCTCTAACAGGAGCTTCCAGATATTGCAACCGCT
TGTACAAGGCGAAGGAAGCCACTCGTTCGTCGGTGGCAGACAGTCCCGCGTCCCTGGCCCCCGAAGATCCGGCCA
AGTCCATCTACCACACGCTCTTGTCGCTGTACCTGAAGCCGCCAGCCGCTCACAAGCAGCAGCTCGAGCCGGCGC
TGGATCTCCTGTCGAAGCACGGGTCCAGGCTCCCTGCCTCTTCAACCCTCGGCCTGGTGCCTGACGATCTGCCGG
TCAGGGCTCTCGAAGCCTACTTCCGAGGCCGCATCCGATCAGTGAACAGCCACGTCAACGAGTCCCGGATCGTCG
CCGGGTTGCGCAAGGCCGAGGGCATCTCCGTTGCGGCCCGATTGCATCTCGGCGACGACGCGGCTGGCGGGCAAG
GCGGGCGCAATCGCCACGTCACCATCAGCGACGAGAGGCACTGCGTCGTCTGTCACAAGAAGCTCGGCGGCGCCA
TGCGCATCGGCGGAAGCGTCGTTGCCGTCTTGCCGGACAACACGGCTGTGCATTATGGCTGCCTTAACAGGGCGA
CCGGGCAGAAAGCGGACAGGCTGCAGGCGCCAAGCTGGGCAAGGGGCGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail