Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04308
Gene name
Locationscaffold_04:2880830..2887191
Strand+
Gene length (bp)6361
Transcript length (bp)4170
Coding sequence length (bp)4170
Protein length (aa) 1390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13259 DUF4050 Protein of unknown function (DUF4050) 6.6E-53 222 410
PF03105 SPX SPX domain 9.0E-12 564 600
PF03105 SPX SPX domain 1.4E-22 601 803
PF00939 Na_sulph_symp Sodium:sulfate symporter transmembrane region 3.2E-32 927 1379
PF03600 CitMHS Citrate transporter 1.1E-24 960 1321

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 917 939 22
2 952 974 22
3 1007 1029 22
4 1053 1075 22
5 1097 1116 19
6 1137 1159 22
7 1179 1196 17
8 1203 1225 22
9 1235 1257 22
10 1270 1292 22
11 1318 1340 22
12 1360 1382 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04308
MAANTDFFPPNTPPSPGQSSLLRQEGSPARLRRAESKSAMIFSDFYKGPRSPLAKLLHSHSQPQAESPVATPDWA
SAEYADLLSRDKNRQKEAIVRYLDDKVRSDWDFPWPPLGPKLPKVENQPAASGDQQSEGDQQVQDETRDDDGYQA
DGGSSDMEETSGLEVGVDEIKKDDDVQSIYSIVSEDAIHYRPRLESPSDFSDNELPSPNRLSIAEPLRLHSKTRE
MERKTRRRRALRDEMTWNDGLACFEARRNAWTGAKTVRVRSKPMSPSSTSPRSPRRFFARHSVSGSPPTSANSGA
VQSAGASGTTASEASSLVRDAERELNKHQTRESTASDPVSPDDHPVETLVPVGQPLLPPNSPLRATVTPAIYNNI
YDKVVLNSLQPACPVNLSDMLRACVTGWKRDGEWPPRPAAADPAVAVRRSKKSAAVGGDCGEKRRGFFDECYSER
QRRVLMARSDHVIFSGHVYEDEDEEEDEEEEEEEEEEEEEDFEDEAYDYEFHNWGIKLHRQEAHRIQAQQNSTDE
HKKSPSAVELADYPRSDAHHRRRRKRLWKRRWLEKQDDMKFSHSIQFNAVPDWSSHYIAYSNLKKLIYQLERTVH
QSRSNDVESRPLVAADNPDDVFSVALNVELDKICSFYVVKQKEVLDEAAQLLRDIQDRSHPLDGAAPLRRVVSDG
HQGRGVTSDDEDGEDSASDDDETTGLNKPGHTRRKRLSSVGHRQDLASSAEFTRSRRLSNVIDYYEEPSLMLLQD
LHSSAIMLKKRIIGLYVQSCELKSYVQLNRTGFAKVLKKFDKILFRELKGPYLGSHVDTAYPFRPDTRKLVDDNI
AQMEAAYADVVTGGDTGTANKELRSHLREHVVWERNTVWRDLIGIERRAEAARLGQSLLGQDQAVALQGDAADGL
PAFKHMQTPLGRVSLPVWLANGSIPTLVISIAIFFALLFVPILQRAEQQNCLAMLVFVSILWATETIPLFVTSLL
VPFLSVVLRVVREEDPDKLPVRLDSRGATHAIFASMWTPVIMLLLGGFTLAAALSKCTIDKRLATLILSKAGTRP
RTVLLANMFVAAFASMLISNVAAPVLCYSIIEPMLRTLPSDSDMSKAIIIGIALASNIGGMLSPIASPQNVVAMG
IMDPEPTWLQWFFIVIPVGAVSLLLIWLLLLVTFQPGKGTVIVPIRPLKEPFTGVQWFVSLVAIATVALWCASHQ
MEGVFGDMGVIAIMPIVLFFGIGILTKEDFNNFPWTIIILAAGGLSLGKAVRSSGLLHVFAEVVSENVQGMSLYG
ILFVFSTLILVIATFISHTVAALIFLPLVYDVGAAMDQPQPNLLVMGGVLMCSAAMGLPTSGFPNMTAIMKEDAA
GQRYLRVKHFITRGVPSSVFTLLVVMTLGFGIMEVAGLD*
Coding >Ophcf2|04308
ATGGCTGCAAATACAGATTTCTTTCCGCCCAACACTCCACCCTCACCTGGCCAATCGTCCCTTCTCCGCCAGGAA
GGCTCACCGGCTCGATTACGTCGGGCTGAGTCCAAATCCGCCATGATCTTCTCCGACTTCTACAAGGGCCCGCGC
TCTCCTTTGGCCAAGCTGCTGCATTCACACTCCCAACCGCAGGCCGAGTCGCCCGTCGCCACTCCAGACTGGGCA
TCCGCCGAGTACGCAGATTTATTGAGCAGGGACAAAAACAGGCAGAAAGAGGCCATCGTGCGCTACTTGGATGAC
AAGGTCAGGTCTGACTGGGATTTTCCTTGGCCTCCGCTCGGCCCAAAGCTGCCCAAAGTCGAGAACCAACCAGCA
GCCAGCGGTGACCAACAGAGCGAGGGCGACCAACAAGTCCAGGACGAGACCCGTGACGACGATGGATACCAAGCA
GACGGCGGCTCCTCCGACATGGAAGAGACGTCAGGGCTGGAAGTAGGAGTCGACGAAATCAAAAAGGATGACGAT
GTCCAGTCCATCTACAGCATTGTGTCGGAAGACGCCATCCACTATCGCCCTCGCCTCGAGTCGCCCTCGGACTTT
TCCGACAATGAGCTTCCATCCCCTAACCGGCTCAGCATCGCCGAGCCTCTACGTTTGCACTCCAAGACGCGGGAA
ATGGAACGCAAGACTCGACGTCGTAGGGCTTTACGTGACGAGATGACGTGGAACGATGGGTTGGCATGTTTTGAG
GCTCGTCGAAACGCATGGACGGGCGCAAAGACTGTGCGTGTCCGAAGCAAGCCCATGTCTCCGTCGTCTACGTCT
CCGCGTTCGCCTCGACGATTCTTCGCCCGTCACTCCGTGTCTGGCTCGCCCCCGACTTCAGCCAACAGCGGCGCG
GTGCAGAGTGCGGGCGCGTCGGGCACCACCGCCTCGGAGGCCTCGTCGCTCGTCCGAGACGCTGAGAGAGAACTC
AACAAGCATCAGACGCGTGAGTCGACGGCTTCAGATCCAGTGTCGCCTGACGATCACCCCGTCGAGACGCTTGTG
CCTGTTGGGCAGCCGCTGCTCCCTCCGAACAGCCCGTTGCGCGCAACTGTGACCCCGGCAATATACAACAACATT
TACGACAAGGTGGTGCTCAACAGCTTGCAGCCCGCCTGCCCCGTCAACCTATCCGACATGCTACGGGCCTGTGTC
ACCGGTTGGAAGAGAGACGGCGAATGGCCTCCCCGACCGGCTGCTGCGGATCCTGCCGTGGCCGTGCGTCGCAGC
AAGAAATCGGCGGCCGTTGGAGGTGACTGTGGGGAGAAGAGGAGGGGCTTCTTTGACGAGTGCTACTCTGAGCGG
CAGAGAAGAGTCTTGATGGCCCGTTCGGACCACGTGATCTTCAGCGGCCACGTCTACGAAGACGAAGACGAAGAA
GAAGACGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGACTTCGAAGACGAAGCCTACGACTACGAG
TTTCATAACTGGGGCATTAAGCTCCACCGCCAGGAGGCCCACCGCATTCAGGCCCAACAAAACTCTACTGACGAG
CACAAAAAGAGCCCTTCTGCCGTCGAACTCGCCGATTATCCCCGATCCGACGCACATCACAGAAGGCGCCGCAAG
CGATTGTGGAAGCGTCGCTGGCTCGAGAAGCAGGACGATATGAAGTTTTCGCATAGTATCCAGTTCAATGCTGTT
CCCGACTGGAGCAGCCATTACATTGCCTACAGCAACCTCAAGAAGCTCATCTATCAGCTCGAGAGGACGGTTCAT
CAGAGTCGATCCAATGACGTCGAATCTAGGCCCCTCGTCGCCGCGGATAATCCGGATGATGTCTTTTCCGTCGCC
CTCAACGTCGAGCTCGACAAGATCTGCTCCTTTTACGTCGTGAAGCAGAAAGAGGTGCTCGATGAGGCTGCCCAA
CTCCTCCGCGATATCCAGGATCGGTCCCATCCGCTTGACGGCGCCGCCCCTCTGCGAAGAGTCGTCTCTGATGGC
CACCAAGGTCGGGGCGTCACGTCCGACGACGAAGACGGCGAGGATAGCGCCAGCGACGACGATGAGACTACCGGT
CTGAATAAGCCTGGACATACTCGCAGAAAGAGGCTTTCCTCCGTCGGCCATCGCCAGGATCTGGCCTCGTCTGCC
GAGTTTACTCGTTCGCGCCGGCTCAGCAACGTAATCGACTATTACGAAGAGCCGTCTCTCATGCTGCTGCAGGAC
CTACATTCGTCCGCCATCATGCTCAAGAAGCGCATCATCGGCCTCTACGTCCAATCGTGCGAACTCAAGTCGTAC
GTCCAGCTCAACAGAACAGGCTTCGCAAAAGTCCTCAAAAAGTTCGACAAGATCCTCTTCAGGGAGCTCAAGGGC
CCGTATCTCGGCTCCCACGTCGACACGGCCTACCCCTTTAGACCGGACACGAGGAAGCTGGTCGACGACAACATC
GCTCAGATGGAAGCCGCCTACGCCGATGTCGTCACCGGAGGCGACACGGGCACGGCAAACAAGGAGTTGCGCTCT
CACCTGCGAGAGCATGTCGTCTGGGAGCGAAATACGGTCTGGAGGGACTTGATCGGCATCGAGCGTCGGGCTGAG
GCTGCTCGGCTTGGACAGTCGCTTCTTGGTCAGGATCAGGCTGTGGCGTTGCAGGGCGACGCCGCCGATGGTCTG
CCTGCTTTCAAGCACATGCAGACGCCCCTGGGCCGTGTTTCGCTGCCGGTCTGGCTGGCAAACGGGTCGATACCG
ACGCTCGTCATCTCCATCGCCATCTTTTTCGCTCTCCTCTTCGTCCCCATCCTGCAAAGGGCCGAGCAGCAGAAC
TGTCTGGCCATGCTCGTCTTCGTCAGCATCCTCTGGGCGACCGAGACAATACCGCTCTTCGTCACCTCGCTGCTG
GTGCCCTTCCTCTCCGTCGTCCTAAGGGTGGTCCGCGAGGAGGACCCGGACAAACTCCCCGTCCGTCTCGACTCT
CGAGGGGCGACGCATGCCATCTTCGCCTCCATGTGGACCCCCGTCATCATGCTGCTGCTGGGCGGCTTCACCCTC
GCCGCTGCGCTGTCCAAGTGCACCATCGACAAGCGGCTGGCTACGCTTATCCTCAGCAAGGCCGGCACTCGGCCG
CGAACTGTGCTGTTGGCCAACATGTTTGTCGCCGCCTTTGCTTCGATGCTTATCAGCAACGTGGCCGCTCCTGTT
CTCTGCTACTCCATCATCGAGCCGATGCTGCGGACGCTGCCGTCCGACTCGGACATGTCAAAGGCCATCATCATC
GGCATCGCCCTGGCGTCCAACATTGGCGGCATGCTCTCGCCCATAGCCTCTCCGCAGAACGTAGTGGCCATGGGC
ATCATGGACCCGGAGCCGACCTGGCTGCAGTGGTTCTTCATCGTCATTCCCGTCGGCGCCGTCTCGCTGCTGCTT
ATCTGGCTGCTGCTCCTCGTCACCTTTCAGCCTGGCAAGGGCACCGTCATCGTCCCGATCCGGCCGCTCAAGGAG
CCGTTTACGGGCGTGCAGTGGTTCGTGTCGCTCGTTGCCATTGCCACAGTGGCCTTGTGGTGCGCGAGCCATCAG
ATGGAGGGCGTCTTTGGCGACATGGGAGTCATCGCCATCATGCCCATCGTTCTGTTCTTTGGCATCGGTATCCTC
ACCAAGGAGGACTTTAACAACTTTCCCTGGACCATCATCATCTTGGCTGCTGGCGGGCTATCGCTGGGTAAGGCG
GTGCGGTCGTCGGGATTGTTGCACGTCTTCGCTGAGGTGGTGTCGGAAAATGTCCAAGGCATGAGCCTTTACGGC
ATTCTCTTCGTCTTCTCAACCTTGATACTCGTCATCGCCACTTTTATCAGCCATACGGTGGCGGCTCTCATCTTT
CTGCCGCTGGTGTACGACGTGGGCGCGGCCATGGACCAGCCGCAGCCGAACCTGCTCGTCATGGGCGGCGTCCTC
ATGTGCAGCGCGGCCATGGGATTGCCTACGAGTGGCTTCCCCAATATGACTGCTATTATGAAGGAGGATGCTGCG
GGGCAGAGATATCTGCGTGTGAAGCATTTCATTACCAGGGGTGTACCGAGCAGTGTCTTTACGCTGCTGGTTGTC
ATGACGCTCGGGTTTGGTATCATGGAGGTTGCTGGCTTGGATTAG
Transcript >Ophcf2|04308
ATGGCTGCAAATACAGATTTCTTTCCGCCCAACACTCCACCCTCACCTGGCCAATCGTCCCTTCTCCGCCAGGAA
GGCTCACCGGCTCGATTACGTCGGGCTGAGTCCAAATCCGCCATGATCTTCTCCGACTTCTACAAGGGCCCGCGC
TCTCCTTTGGCCAAGCTGCTGCATTCACACTCCCAACCGCAGGCCGAGTCGCCCGTCGCCACTCCAGACTGGGCA
TCCGCCGAGTACGCAGATTTATTGAGCAGGGACAAAAACAGGCAGAAAGAGGCCATCGTGCGCTACTTGGATGAC
AAGGTCAGGTCTGACTGGGATTTTCCTTGGCCTCCGCTCGGCCCAAAGCTGCCCAAAGTCGAGAACCAACCAGCA
GCCAGCGGTGACCAACAGAGCGAGGGCGACCAACAAGTCCAGGACGAGACCCGTGACGACGATGGATACCAAGCA
GACGGCGGCTCCTCCGACATGGAAGAGACGTCAGGGCTGGAAGTAGGAGTCGACGAAATCAAAAAGGATGACGAT
GTCCAGTCCATCTACAGCATTGTGTCGGAAGACGCCATCCACTATCGCCCTCGCCTCGAGTCGCCCTCGGACTTT
TCCGACAATGAGCTTCCATCCCCTAACCGGCTCAGCATCGCCGAGCCTCTACGTTTGCACTCCAAGACGCGGGAA
ATGGAACGCAAGACTCGACGTCGTAGGGCTTTACGTGACGAGATGACGTGGAACGATGGGTTGGCATGTTTTGAG
GCTCGTCGAAACGCATGGACGGGCGCAAAGACTGTGCGTGTCCGAAGCAAGCCCATGTCTCCGTCGTCTACGTCT
CCGCGTTCGCCTCGACGATTCTTCGCCCGTCACTCCGTGTCTGGCTCGCCCCCGACTTCAGCCAACAGCGGCGCG
GTGCAGAGTGCGGGCGCGTCGGGCACCACCGCCTCGGAGGCCTCGTCGCTCGTCCGAGACGCTGAGAGAGAACTC
AACAAGCATCAGACGCGTGAGTCGACGGCTTCAGATCCAGTGTCGCCTGACGATCACCCCGTCGAGACGCTTGTG
CCTGTTGGGCAGCCGCTGCTCCCTCCGAACAGCCCGTTGCGCGCAACTGTGACCCCGGCAATATACAACAACATT
TACGACAAGGTGGTGCTCAACAGCTTGCAGCCCGCCTGCCCCGTCAACCTATCCGACATGCTACGGGCCTGTGTC
ACCGGTTGGAAGAGAGACGGCGAATGGCCTCCCCGACCGGCTGCTGCGGATCCTGCCGTGGCCGTGCGTCGCAGC
AAGAAATCGGCGGCCGTTGGAGGTGACTGTGGGGAGAAGAGGAGGGGCTTCTTTGACGAGTGCTACTCTGAGCGG
CAGAGAAGAGTCTTGATGGCCCGTTCGGACCACGTGATCTTCAGCGGCCACGTCTACGAAGACGAAGACGAAGAA
GAAGACGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGAAGACTTCGAAGACGAAGCCTACGACTACGAG
TTTCATAACTGGGGCATTAAGCTCCACCGCCAGGAGGCCCACCGCATTCAGGCCCAACAAAACTCTACTGACGAG
CACAAAAAGAGCCCTTCTGCCGTCGAACTCGCCGATTATCCCCGATCCGACGCACATCACAGAAGGCGCCGCAAG
CGATTGTGGAAGCGTCGCTGGCTCGAGAAGCAGGACGATATGAAGTTTTCGCATAGTATCCAGTTCAATGCTGTT
CCCGACTGGAGCAGCCATTACATTGCCTACAGCAACCTCAAGAAGCTCATCTATCAGCTCGAGAGGACGGTTCAT
CAGAGTCGATCCAATGACGTCGAATCTAGGCCCCTCGTCGCCGCGGATAATCCGGATGATGTCTTTTCCGTCGCC
CTCAACGTCGAGCTCGACAAGATCTGCTCCTTTTACGTCGTGAAGCAGAAAGAGGTGCTCGATGAGGCTGCCCAA
CTCCTCCGCGATATCCAGGATCGGTCCCATCCGCTTGACGGCGCCGCCCCTCTGCGAAGAGTCGTCTCTGATGGC
CACCAAGGTCGGGGCGTCACGTCCGACGACGAAGACGGCGAGGATAGCGCCAGCGACGACGATGAGACTACCGGT
CTGAATAAGCCTGGACATACTCGCAGAAAGAGGCTTTCCTCCGTCGGCCATCGCCAGGATCTGGCCTCGTCTGCC
GAGTTTACTCGTTCGCGCCGGCTCAGCAACGTAATCGACTATTACGAAGAGCCGTCTCTCATGCTGCTGCAGGAC
CTACATTCGTCCGCCATCATGCTCAAGAAGCGCATCATCGGCCTCTACGTCCAATCGTGCGAACTCAAGTCGTAC
GTCCAGCTCAACAGAACAGGCTTCGCAAAAGTCCTCAAAAAGTTCGACAAGATCCTCTTCAGGGAGCTCAAGGGC
CCGTATCTCGGCTCCCACGTCGACACGGCCTACCCCTTTAGACCGGACACGAGGAAGCTGGTCGACGACAACATC
GCTCAGATGGAAGCCGCCTACGCCGATGTCGTCACCGGAGGCGACACGGGCACGGCAAACAAGGAGTTGCGCTCT
CACCTGCGAGAGCATGTCGTCTGGGAGCGAAATACGGTCTGGAGGGACTTGATCGGCATCGAGCGTCGGGCTGAG
GCTGCTCGGCTTGGACAGTCGCTTCTTGGTCAGGATCAGGCTGTGGCGTTGCAGGGCGACGCCGCCGATGGTCTG
CCTGCTTTCAAGCACATGCAGACGCCCCTGGGCCGTGTTTCGCTGCCGGTCTGGCTGGCAAACGGGTCGATACCG
ACGCTCGTCATCTCCATCGCCATCTTTTTCGCTCTCCTCTTCGTCCCCATCCTGCAAAGGGCCGAGCAGCAGAAC
TGTCTGGCCATGCTCGTCTTCGTCAGCATCCTCTGGGCGACCGAGACAATACCGCTCTTCGTCACCTCGCTGCTG
GTGCCCTTCCTCTCCGTCGTCCTAAGGGTGGTCCGCGAGGAGGACCCGGACAAACTCCCCGTCCGTCTCGACTCT
CGAGGGGCGACGCATGCCATCTTCGCCTCCATGTGGACCCCCGTCATCATGCTGCTGCTGGGCGGCTTCACCCTC
GCCGCTGCGCTGTCCAAGTGCACCATCGACAAGCGGCTGGCTACGCTTATCCTCAGCAAGGCCGGCACTCGGCCG
CGAACTGTGCTGTTGGCCAACATGTTTGTCGCCGCCTTTGCTTCGATGCTTATCAGCAACGTGGCCGCTCCTGTT
CTCTGCTACTCCATCATCGAGCCGATGCTGCGGACGCTGCCGTCCGACTCGGACATGTCAAAGGCCATCATCATC
GGCATCGCCCTGGCGTCCAACATTGGCGGCATGCTCTCGCCCATAGCCTCTCCGCAGAACGTAGTGGCCATGGGC
ATCATGGACCCGGAGCCGACCTGGCTGCAGTGGTTCTTCATCGTCATTCCCGTCGGCGCCGTCTCGCTGCTGCTT
ATCTGGCTGCTGCTCCTCGTCACCTTTCAGCCTGGCAAGGGCACCGTCATCGTCCCGATCCGGCCGCTCAAGGAG
CCGTTTACGGGCGTGCAGTGGTTCGTGTCGCTCGTTGCCATTGCCACAGTGGCCTTGTGGTGCGCGAGCCATCAG
ATGGAGGGCGTCTTTGGCGACATGGGAGTCATCGCCATCATGCCCATCGTTCTGTTCTTTGGCATCGGTATCCTC
ACCAAGGAGGACTTTAACAACTTTCCCTGGACCATCATCATCTTGGCTGCTGGCGGGCTATCGCTGGGTAAGGCG
GTGCGGTCGTCGGGATTGTTGCACGTCTTCGCTGAGGTGGTGTCGGAAAATGTCCAAGGCATGAGCCTTTACGGC
ATTCTCTTCGTCTTCTCAACCTTGATACTCGTCATCGCCACTTTTATCAGCCATACGGTGGCGGCTCTCATCTTT
CTGCCGCTGGTGTACGACGTGGGCGCGGCCATGGACCAGCCGCAGCCGAACCTGCTCGTCATGGGCGGCGTCCTC
ATGTGCAGCGCGGCCATGGGATTGCCTACGAGTGGCTTCCCCAATATGACTGCTATTATGAAGGAGGATGCTGCG
GGGCAGAGATATCTGCGTGTGAAGCATTTCATTACCAGGGGTGTACCGAGCAGTGTCTTTACGCTGCTGGTTGTC
ATGACGCTCGGGTTTGGTATCATGGAGGTTGCTGGCTTGGATTAG
Gene >Ophcf2|04308
ATGGCTGCACGTTACCAAAGAACCCCATTGTTTTGTCGAGTCCTCCGCTGAGCTTCTTGCTTCCAGGCAAATACA
GATTTCTTTCCGCCCAACACTCCACCCTCACCTGGCCAATCGTCCCTTCTCCGCCAGGAAGGCTCACCGGCTCGA
TTACGTCGGGCTGAGTCCAAATCCGCCATGATCTTCTCCGACTTCTACAAGGGCCCGCGCTCTCCTTTGGCCAAG
CTGCTGCATTCACACTCCCAACCGCAGGCCGAGTCGCCCGTCGCCACTCCAGACTGGGCATCCGCCGAGTACGCA
GATTTATTGAGCAGGGACAAAAACAGGCAGAAAGAGGCCATCGTGCGCTACTTGGATGACAAGGTCAGGTCTGAC
TGGGATTTTCCTTGGCCTCCGCTCGGCCCAAAGCTGCCCAAAGTCGAGAACCAACCAGCAGCCAGCGGTGACCAA
CAGAGCGAGGGCGACCAACAAGTCCAGGACGAGACCCGTGACGACGATGGATACCAAGCAGACGGCGGCTCCTCC
GACATGGAAGAGACGTCAGGGCTGGAAGTAGGAGTCGACGAAATCAAAAAGGATGACGATGTCCAGTCCATCTAC
AGCATTGTGTCGGAAGACGCCATCCACTATCGCCCTCGCCTCGAGTCGCCCTCGGACTTTTCCGACAATGAGCTT
CCATCCCCTAACCGGCTCAGCATCGCCGAGCCTCTACGTTTGCACTCCAAGACGCGGGAAATGGAACGCAAGACT
CGACGTCGTAGGGCTTTACGTGACGAGATGACGTGGAACGATGGGTTGGCATGTTTTGAGGCTCGTCGAAACGCA
TGGACGGGCGCAAAGACTGTGCGTGTCCGAAGCAAGCCCATGTCTCCGTCGTCTACGTCTCCGCGTTCGCCTCGA
CGATTCTTCGCCCGTCACTCCGTGTCTGGCTCGCCCCCGACTTCAGCCAACAGCGGCGCGGTGCAGAGTGCGGGC
GCGTCGGGCACCACCGCCTCGGAGGCCTCGTCGCTCGTCCGAGACGCTGAGAGAGAACTCAACAAGCATCAGACG
CGTGAGTCGACGGCTTCAGATCCAGTGTCGCCTGACGATCACCCCGTCGAGACGCTTGTGCCTGTTGGGCAGCCG
CTGCTCCCTCCGAACAGCCCGTTGCGCGCAACTGTGACCCCGGCAATATACAACAACATTTACGACAAGGTGGTG
CTCAACAGCTTGCAGCCCGCCTGCCCCGTCAACCTATCCGACATGCTACGGGCCTGTGTCACCGGTTGGAAGAGA
GACGGCGAATGGCCTCCCCGACCGGCTGCTGCGGATCCTGCCGTGGCCGTGCGTCGCAGCAAGAAATCGGCGGCC
GTTGGAGGTGACTGTGGGGGTAATGTTGCTCAGCGGATGAGCTTCGGTATCCTCAGCCGGAACAAGGATGATGAA
GGTCGGACGGGCAAGGGATTTCGCCGTAGCCTTCAACGGGCTCTGGGATTGGGCATCGGGCCTGGGAATGGAGAG
TTTATGGAGGGAGCGACGATGAGGGGAAGTTGAAGGAGTCTACGAGTGATGGTCCGTCTTTTCATAGCGTTGACG
ACTCCGCGGAGACGTCTGTTCAGGACGAGGCGATGTGGCTGAATTGGAGGCATGGGGAGTGAGGCTTTGGCATGT
TGGTAGGATAAGATGTGTACAGCATCATCAGGCTGGATTGGGCAGCGTGGCACGCGATGGTGGCATATACCCGCA
GTGTGAGCGAATTGAACGGTCTCATGCAGTGAGTTTTGCAAATTGCAGAGATGGGCTGGACGAATATAATGTTCT
GTTTCTGTCGTTGGCTGCTGCCTGGTTACAGGTTGATGAATTGGATGGGTTGAGACGAGACATGGGGTGCGATGG
CTGGTATGCACGGAGGGAGAGCTTCTGTCTTGCTTCATCTATATTTCGAGACTATCTATATCTGAAGAGGTAAAG
AGGTAAAGAGGTAAAGAGGTAAAGAGGTAAAGAGGTAAAGAGGTAAAGAGGCAAAGAGGATGTTAGGTAGGAAAC
GAAGTTAAGATGGTCGAATAGACAGATATCGTGATAATGTGCGAATAGAGATTGTTTGAGATGAAGTTGTCTGAT
TAGTCAGGTGGAATGGATCTTCGTGTGGATTTAGCGAATCTCATCGACTTTATTTAGCGGGACGGGCTAATGTCT
CACTTGGCAGCTTCCGAGATTGGCTATGGACCTGCTTACGCTGCAGGAGGTTGGACGGGATCCGACCGTGATGCG
CCGGGAGTTTTGAAGTAGAGAAAGCTGTTGTTATAGCTATCGTGTGATGCTCTGAAGGGTGGATGAGAGGCTAGA
ACGTAGAGAAGAGGAGGGGCTTCTTTGACGAGTGCTACTCTGAGCGGCAGAGAAGAGTCTTGATGGCCCGTTCGG
ACCACGTGATCTTCAGCGGCCACGTCTGTGAGGGCCTCGATGCATGTCTTGTGCATGAGCATTCACGGTCATGCG
GGTGCCATCGACAGCGAGGGTGGCTTTGCTTTGTCCGATGCTTGATGGTGGGAGCGACCAACAGGTGAGGGCGTT
TTACGGTGGCATTTTACTTGTCGGTTGACTATTCGACGGCGAGGGACGGTTAGATAGTTGATGTTAGGTATGAAA
GGGAGCAGAAGGAGGGCGGAAGAGCTCTCATACCGTCTCGCCGATGCTTCATCTCAGGTCCAACCAGGGATAAAC
CAGGGATAGCCACCTACCGCTTCTTTCAGTACAAAAGATGGTCCAAGCACGTCAGACAACATACCTACCTACCTA
TCTACCTACCTACCTACATACATACATATCCGTACTTTGTATCCGTACATACACATGCCGACCAGCAGAAACGAC
GGCCGGCATCAAAAGGCCTCCCTCCTGTGACGCCCGTGACGGCCTCGGCGTCGCACCCGGTAAGACGAAGGTGGA
AGTCACATGCAAAGGCGGCGGACGCGAGCGGCGCGCGAGTCATCTGAGTCTGAGACGCTGAGGCGTGCATCAAGG
GAGGCGGCTGATTGGACAAGGAATATTCGTACATACATACTTCGTACAACATACATACAGGCAGAATGCGTAAAT
TGCCGGATGACGGGCATGGATATGAATGCATCGGGCCGCTGGCGCCAAGGCGGCGTGCATGCCTGCTTACGAGGC
TAGCATCAGGAGGTAGACTCTAGGTAGATAGCGGTTGTGAAAAAGGGTCGTCAGTCAGTCTTTAGGAGGTTGCAC
CGTCTGTCTGGCCAAGCTCCAGCTGAATTGCTTTTCCCGCGCAACCTACCACGAAAACAGAGGCCAAGACGCCAC
CACGATTCCGTCAGCGGCTGCCTCCGACGCTCCCTCCTCCGCTGACGCCAACAGACGGCCGACGGGCGATCGAGG
AGGAGGGAGACGCGAAGGTGACGATAGAGTCGACGAAGACGAAGACGAAGACGAAGAAGAAGACGAAGAAGAAGA
AGAAGAAGAAGAAGAAGAAGAAGAAGAAGACTTCGAAGACGAAGCCTACGACTACGAGTTTCATAACTGGGGCAT
TAAGCTCCACCGCCAGGAGGCCCACCGCATTCAGGCCCAACAAAACTCTACTGACGAGCACAAAAAGAGCCCTTC
TGCCGTCGAACTCGCCGATTATCCCCGATCCGACGCACATCACAGAAGGCGCCGCAAGCGATTGTGGAAGCGTCG
CTGGCTCGAGAAGCAGGACGATATGAAGTTTTCGCATAGTATCCAGTTCAATGCTGTTCCCGACTGGAGCAGCCA
TTACATTGCCTACAGCAACCTCAAGAAGCTGTAGGACGCCCTCGCCCCTGATTGCTACTACGGGGCATCCTCCTC
GCTGACCTTGACCTCTACCTAGCATCTATCAGCTCGAGAGGACGGTTCATCAGAGTCGATCCAATGACGTCGAAT
CTAGGCCCCTCGTCGCCGCGGATAATCCGGATGATGTCTTTTCCGTCGCCCTCAACGTCGAGCTCGACAAGATCT
GCTCCTTTTACGTCGTGAAGCAGAAAGAGGTGCTCGATGAGGCTGCCCAACTCCTCCGCGATATCCAGGATCGGT
CCCATCCGCTTGACGGCGCCGCCCCTCTGCGAAGAGTCGTCTCTGATGGCCACCAAGGTCGGGGCGTCACGTCCG
ACGACGAAGACGGCGAGGATAGCGCCAGCGACGACGATGAGACTACCGGTCTGAATAAGCCTGGACATACTCGCA
GAAAGAGGCTTTCCTCCGTCGGCCATCGCCAGGATCTGGCCTCGTCTGCCGAGTTTACTCGTTCGCGCCGGCTCA
GCAACGTAATCGACTATTACGAAGAGCCGTCTCTCATGCTGCTGCAGGACCTACATTCGTCCGCCATCATGCTCA
AGAAGCGCATCATCGGCCTCTACGTCCAATCGTGCGAACTCAAGTCGTACGTCCAGCTCAACAGAACAGGCTTCG
CAAAAGTCCTCAAAAAGTTCGACAAGATCCTCTTCAGGGAGCTCAAGGGCCCGTATCTCGGCTCCCACGTCGACA
CGGCCTACCCCTTTAGACCGGACACGAGGAAGCTGGTCGACGACAACATCGCTCAGATGGAAGCCGCCTACGCCG
ATGTCGTCACCGGAGGCGACACGGGCACGGCAAACAAGGAGTTGCGCTCTCACCTGCGAGAGCATGTCGTCTGGG
AGCGAAATACGGTCTGGAGGGACTTGATCGGCATCGAGCGTCGGGCTGAGGCTGCTCGGCTTGGACAGTCGCTTC
TTGGTCAGGATCAGGCTGTGGCGTTGCAGGGCGACGCCGCCGATGGTCTGCCTGCTTTCAAGCACATGCAGACGC
CCCTGGGCCGTGTTTCGCTGCCGGTCTGGCTGGCAAACGGGTCGATACCGACGCTCGTCATCTCCATCGCCATCT
TTTTCGCTCTCCTCTTCGTCCCCATCCTGCAAAGGGCCGAGCAGCAGAACTGTCTGGCCATGCTCGTCTTCGTCA
GCATCCTCTGGGCGACCGAGGTGAGTGCTGGTCGCGGCCCCTTCACCCCCTCCTCCCGGTTCTTCTCTCCTGACT
GGTCCTCAGACAATACCGCTCTTCGTCACCTCGCTGCTGGTGCCCTTCCTCTCCGTCGTCCTAAGGGTGGTCCGC
GAGGAGGACCCGGACAAACTCCCCGTCCGTCTCGACTCTCGAGGGGCGACGCATGCCATCTTCGCCTCCATGTGG
ACCCCCGTCATCATGCTGCTGCTGGGCGGCTTCACCCTCGCCGCTGCGCTGTCCAAGTGCACCATCGACAAGCGG
CTGGCTACGCTTATCCTCAGCAAGGCCGGCACTCGGCCGCGAACTGTGCTGTTGGCCAACATGTTTGTCGCCGCC
TTTGCTTCGATGCTTATCAGCAACGTGGCCGCTCCTGTTCTCTGCTACTCCATCATCGAGCCGATGCTGCGGACG
CTGCCGTCCGACTCGGACATGTCAAAGGCCATCATCATCGGCATCGCCCTGGCGTCCAACATTGGCGGCATGCTC
TCGCCCATAGCCTCTCCGCAGAACGTAGTGGCCATGGGCATCATGGACCCGGAGCCGACCTGGCTGCAGTGGTTC
TTCATCGTCATTCCCGTCGGCGCCGTCTCGCTGCTGCTTATCTGGCTGCTGCTCCTCGTCACCTTTCAGCCTGGC
AAGGGCACCGTCATCGTCCCGATCCGGCCGCTCAAGGAGCCGTTTACGGGCGTGCAGTGGTTCGTGTCGCTCGTT
GCCATTGCCACAGTGGCCTTGTGGTGCGCGAGCCATCAGATGGAGGGCGTCTTTGGCGACATGGGAGTCATCGCC
ATCATGCCCATCGTTCTGTTCTTTGGCATCGGTATCCTCACCAAGGAGGACTTTAACAACTTTCCCTGGACCATC
ATCATCTTGGCTGCTGGCGGGCTATCGCTGGGTAAGGCGGTGCGGTCGTCGGGATTGTTGCACGTCTTCGCTGAG
GTGGTGTCGGAAAATGTCCAAGGCATGAGCCTTTACGGCATTCTCTTCGTCTTCTCAACCTTGATACTCGTCATC
GCCACTTTTATCAGCCATACGGTGGCGGCTCTCATCTTTCTGCCGCTGGTGTACGACGTGGGCGCGGCCATGGAC
CAGCCGCAGCCGAACCTGCTCGTCATGGGCGGCGTCCTCATGTGCAGCGCGGCCATGGGATTGCCTACGAGTGGC
TTCCCCAATATGAGTATGTTTTCATCCCTCACGAGAGTTGGTTGGGCGTAGCTGACGAGATGTAGCTGCTATTAT
GAAGGAGGATGCTGCGGGGCAGAGATATCTGCGTGTGAAGCATTTCATTACCAGGGGTGTACCGAGCAGTGTCTT
TACGCTGCTGGTTGTCATGACGCTCGGGTTTGGTATCATGGAGGTTGCTGGCTTGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail