Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04302
Gene name
Locationscaffold_04:2865932..2866825
Strand-
Gene length (bp)893
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 3.3E-63 11 171
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 5.8E-35 11 125
PF00025 Arf ADP-ribosylation factor family 8.1E-13 10 146
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.5E-07 11 117

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole|Golgi apparatus 0.3394 0.1709 0.0218 0.5289 0.1069 0.0022 0.2846 0.6794 0.7476 0.026

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3190
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3350
Ophiocordyceps australis map64 (Brazil) OphauB2|2523
Ophiocordyceps camponoti-floridani Ophcf2|04302 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2119
Ophiocordyceps kimflemingae Ophio5|1397
Ophiocordyceps subramaniannii Hirsu2|5729

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04302
MANDEYDFLFKVVLIGDSGVGKSNLLSRFTRNEFNLDSKSTIGVEFATRSIQVDSKTIKAQIWDTAGQERYRAIT
SAYYRGAVGALLVYDISKHQTYENVTRWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTEEAKSFASKNHLSFIE
TSALDASNVELAFQNILTEIYRIVSSKALDSGDGAQATIGAGTNISLSKPADDDAAKSGKCC*
Coding >Ophcf2|04302
ATGGCCAACGATGAATATGATTTTCTCTTCAAAGTCGTTCTAATCGGAGACTCCGGCGTTGGTAAATCCAACCTT
CTTAGCAGGTTCACGCGCAACGAGTTCAACCTGGACTCCAAGTCGACGATTGGCGTCGAGTTTGCCACCAGGTCC
ATTCAGGTCGACTCCAAGACAATCAAGGCGCAGATCTGGGACACAGCGGGACAGGAACGATACCGTGCCATCACC
TCTGCCTACTATCGAGGCGCTGTGGGAGCCCTGCTCGTCTACGACATCAGCAAGCATCAGACGTACGAAAATGTA
ACCCGCTGGCTCAAAGAGTTGCGTGATCATGCCGATTCCAACATCGTCATCATGCTTGTCGGAAACAAGAGCGAT
TTGAGACACCTGCGGGCCGTTCCGACTGAGGAGGCCAAGTCTTTTGCTAGCAAGAACCACTTGTCGTTTATCGAG
ACGTCCGCCTTGGACGCCAGCAACGTCGAGCTGGCCTTCCAAAACATCCTCACCGAAATTTACCGGATCGTTTCC
AGCAAGGCTCTCGACAGCGGAGACGGAGCCCAGGCCACGATTGGCGCCGGCACCAACATCTCCCTCAGCAAACCT
GCAGATGACGACGCAGCCAAGAGCGGCAAATGCTGCTAA
Transcript >Ophcf2|04302
ATGGCCAACGATGAATATGATTTTCTCTTCAAAGTCGTTCTAATCGGAGACTCCGGCGTTGGTAAATCCAACCTT
CTTAGCAGGTTCACGCGCAACGAGTTCAACCTGGACTCCAAGTCGACGATTGGCGTCGAGTTTGCCACCAGGTCC
ATTCAGGTCGACTCCAAGACAATCAAGGCGCAGATCTGGGACACAGCGGGACAGGAACGATACCGTGCCATCACC
TCTGCCTACTATCGAGGCGCTGTGGGAGCCCTGCTCGTCTACGACATCAGCAAGCATCAGACGTACGAAAATGTA
ACCCGCTGGCTCAAAGAGTTGCGTGATCATGCCGATTCCAACATCGTCATCATGCTTGTCGGAAACAAGAGCGAT
TTGAGACACCTGCGGGCCGTTCCGACTGAGGAGGCCAAGTCTTTTGCTAGCAAGAACCACTTGTCGTTTATCGAG
ACGTCCGCCTTGGACGCCAGCAACGTCGAGCTGGCCTTCCAAAACATCCTCACCGAAATTTACCGGATCGTTTCC
AGCAAGGCTCTCGACAGCGGAGACGGAGCCCAGGCCACGATTGGCGCCGGCACCAACATCTCCCTCAGCAAACCT
GCAGATGACGACGCAGCCAAGAGCGGCAAATGCTGCTAA
Gene >Ophcf2|04302
ATGGCCAACGATGAATATGATGTTCGCAAAACCCTCATCCCTCCGGCTGTCTCAACCGCTAACTGCAGCGCTACC
AACAGTTTCTCTTCAAAGGTTGTTGCTGCCCCCCCTTGTCGAAAGGACGCCGGTCCAGCGCACCCAGGCTTCGTT
GCTAATACTCCAGCCTCGGGCGTTAGTCGTTCTAATCGGAGACTCCGGCGTTGGTAAATCCAACCTTCTTAGCAG
GTTCACGCGCAACGAGTTCAACCTGGACTCCAAGTCGACGATTGGCGTCGAGTTTGCCACCAGGTCCATTCAGGT
CGACTCCAAGACAATCAAGGCGCAGATCTGGGACACAGCGGGACAGGAACGATACCGTGCCATCACCTCTGCCTA
CTATCGAGGCGCTGTGGGAGCCCTGCTCGTCTACGACATCAGCAAGCATCAGACGTACGAAAATGTAACCCGCTG
GCTCAAAGAGTTGCGTGATCATGCCGATTCCAACATCGTCATCATGCTTGTCGGAAACAAGAGCGATTTGAGACA
CCTGCGGGCCGTTCCGACTGAGGAGGCCAAGTCTTTTGCTAGTAAGCCATGACCATCACTGCCCTGACCTGGGGA
TTTCTAACTCGACGCTCACAGGCAAGAACCACTTGTCGTTTATCGAGACGTCCGCCTTGGACGCCAGCAACGTCG
AGCTGGCCTTCCAAAACATCCTCACCGGTATGCCTCCGTGGATAATAGTAAGGAGACGGGACGCTGACGTGGCCT
CGCGCCCAGAAATTTACCGGATCGTTTCCAGCAAGGCTCTCGACAGCGGAGACGGAGCCCAGGCCACGATTGGCG
CCGGCACCAACATCTCCCTCAGCAAACCTGCAGATGACGACGCAGCCAAGAGCGGCAAATGCTGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail