Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04298
Gene name
Locationscaffold_04:2856407..2858483
Strand+
Gene length (bp)2076
Transcript length (bp)2076
Coding sequence length (bp)2076
Protein length (aa) 692

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2035 0.9331 0.0754 0.0201 0.0506 0.0199 0.0202 0.0111 0.0259 0.016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2058
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3337
Ophiocordyceps australis map64 (Brazil) OphauB2|2518
Ophiocordyceps camponoti-floridani Ophcf2|04298 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2115
Ophiocordyceps kimflemingae Ophio5|1393
Ophiocordyceps subramaniannii Hirsu2|2372

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04298
MSKSGMVATRKSARTDIRSAHRRKSGPVSRRRRRASPSSSNNDDQGSDFHPEDDAPYPGRKENKRGRKRRAPLTD
VDSNDTVLSLSEPSRRGSQEPRAKSRQPATLPDDHEPTSLIPNWKDARITFDCWTNIFFFAATSASVDGLSTGWL
VQAATSCQAFAEPALTALYRCPPIKNTLKAKRLAALLDRPPSETLFNYRVKVEALYINVHIVPQTLMYQLVHPLG
RLKELLIYTPLDQPPYRELERNIRWQYAEDVFRSLAAAEADSSKAEAKSFPTILESWEWSGRFIGGYVADLMSVA
SIHETRSFSSLTKLSFTNFQLPSLANVRLRPDSDEEALRAEQEDGQVIEAVAHAISRLKYLDHLVFESSTVLNDR
LLPLLPKNLAHLELINCWEVNSKDLAEFLITHGSRLRTLNLMHNQSLDLSFLTTLSETCPNLRELRINMSYYRHH
ESFNDSDPMYEWALLPTQVPQWPPSLRVISIEHIRNWTVEAAEVLFQSLINSAPRLPCLRHLSIKTRLDIPWQVR
ATMRREWRATMETVFLRPTACPRPHTSLHTPITNDVQPPRAPKRRRTTATSPPSRRSGRIAAANVGSRISSSKRL
RRRQQARPSYKDPDTDEDEAYEEDTDDEDAQNVSSADSADGETGPTIQGLCETVNLQFDNQKVRELQWGMEDFLD
LDDKVESEDEWEGDED*
Coding >Ophcf2|04298
ATGTCAAAGTCTGGAATGGTGGCCACCCGCAAATCGGCACGGACCGACATCCGGAGTGCTCACCGCCGGAAGTCT
GGGCCTGTTTCTCGCCGGCGTCGACGAGCATCACCATCTTCTTCCAATAACGATGACCAAGGAAGCGATTTTCAT
CCTGAAGACGACGCACCCTATCCGGGCCGCAAAGAGAATAAACGCGGCAGAAAACGTCGCGCGCCTCTAACAGAT
GTCGACTCTAATGACACGGTTTTGTCCCTGTCGGAGCCGTCTCGACGAGGCTCTCAGGAACCGCGAGCCAAGAGT
CGCCAGCCGGCTACGCTTCCAGACGACCATGAACCAACCAGTCTGATCCCGAACTGGAAGGATGCGCGCATCACT
TTTGACTGCTGGACAAACATATTTTTTTTCGCCGCGACCTCAGCATCGGTCGACGGCCTTTCCACAGGCTGGCTC
GTTCAAGCCGCCACTTCATGTCAAGCTTTTGCCGAGCCGGCTCTGACGGCGCTCTACCGATGTCCTCCAATAAAA
AACACCTTGAAAGCCAAGCGTCTCGCCGCCTTGCTCGATCGCCCCCCTTCGGAAACCCTCTTTAATTACCGAGTC
AAGGTCGAGGCCCTGTACATCAACGTTCACATCGTCCCCCAGACCCTCATGTACCAGCTAGTTCATCCTCTTGGA
CGGCTCAAGGAGCTCCTCATCTACACTCCATTGGACCAGCCGCCCTACAGAGAACTGGAAAGGAATATCCGGTGG
CAATATGCGGAAGACGTCTTTCGCTCACTGGCAGCTGCGGAAGCGGACTCAAGCAAGGCTGAAGCCAAGTCTTTT
CCCACGATCCTTGAGAGCTGGGAGTGGAGTGGGAGGTTCATCGGCGGCTATGTTGCCGACTTGATGTCGGTGGCT
TCGATTCACGAAACACGGTCCTTCTCGTCTCTCACAAAGCTCAGCTTTACCAACTTTCAACTGCCATCCTTAGCC
AATGTGCGGCTCAGGCCAGATAGCGACGAGGAGGCGCTTCGAGCTGAACAAGAGGATGGCCAGGTGATTGAGGCC
GTTGCTCATGCCATCTCACGCTTGAAATACCTCGACCATCTGGTGTTTGAGTCTTCAACCGTATTGAATGACCGC
CTGCTCCCTCTGTTGCCCAAGAACCTCGCCCATCTAGAGCTCATCAACTGCTGGGAAGTCAACTCAAAGGATCTC
GCAGAATTCCTCATCACGCACGGCAGCAGGCTGCGAACCTTGAACCTGATGCACAACCAGTCCTTGGACCTGAGC
TTCTTGACCACCTTATCCGAAACGTGCCCCAACCTCCGAGAACTCCGCATCAACATGTCGTACTACCGTCACCAT
GAAAGCTTCAACGATTCGGATCCCATGTACGAATGGGCCCTTCTCCCGACCCAAGTCCCGCAATGGCCGCCCAGC
CTCAGGGTGATAAGCATCGAGCACATACGCAACTGGACCGTCGAGGCCGCAGAGGTCTTATTCCAATCTCTCATC
AACAGCGCCCCGAGATTACCCTGCCTCCGTCACCTCTCTATCAAGACCAGACTCGACATACCCTGGCAAGTCCGT
GCGACGATGCGTCGCGAATGGCGCGCCACCATGGAAACAGTCTTCCTCCGTCCCACCGCCTGCCCCCGGCCGCAC
ACGAGCCTTCACACGCCAATAACGAACGACGTCCAACCGCCGCGAGCTCCCAAGAGGCGTCGCACGACGGCAACC
AGCCCTCCCTCTCGCCGGAGCGGGAGGATCGCAGCCGCCAACGTCGGCAGTCGCATCTCGTCAAGCAAACGTCTC
CGCCGCCGCCAACAGGCAAGACCCTCGTACAAGGATCCGGATACGGACGAAGATGAGGCCTACGAGGAAGACACC
GATGATGAAGACGCCCAGAACGTCTCTTCCGCCGACTCGGCCGACGGAGAAACTGGCCCGACCATCCAGGGCCTT
TGCGAAACCGTCAACCTCCAATTCGACAACCAAAAGGTCCGCGAACTGCAGTGGGGCATGGAAGACTTTCTCGAC
CTCGACGACAAGGTCGAGTCGGAGGATGAATGGGAGGGAGACGAGGACTAA
Transcript >Ophcf2|04298
ATGTCAAAGTCTGGAATGGTGGCCACCCGCAAATCGGCACGGACCGACATCCGGAGTGCTCACCGCCGGAAGTCT
GGGCCTGTTTCTCGCCGGCGTCGACGAGCATCACCATCTTCTTCCAATAACGATGACCAAGGAAGCGATTTTCAT
CCTGAAGACGACGCACCCTATCCGGGCCGCAAAGAGAATAAACGCGGCAGAAAACGTCGCGCGCCTCTAACAGAT
GTCGACTCTAATGACACGGTTTTGTCCCTGTCGGAGCCGTCTCGACGAGGCTCTCAGGAACCGCGAGCCAAGAGT
CGCCAGCCGGCTACGCTTCCAGACGACCATGAACCAACCAGTCTGATCCCGAACTGGAAGGATGCGCGCATCACT
TTTGACTGCTGGACAAACATATTTTTTTTCGCCGCGACCTCAGCATCGGTCGACGGCCTTTCCACAGGCTGGCTC
GTTCAAGCCGCCACTTCATGTCAAGCTTTTGCCGAGCCGGCTCTGACGGCGCTCTACCGATGTCCTCCAATAAAA
AACACCTTGAAAGCCAAGCGTCTCGCCGCCTTGCTCGATCGCCCCCCTTCGGAAACCCTCTTTAATTACCGAGTC
AAGGTCGAGGCCCTGTACATCAACGTTCACATCGTCCCCCAGACCCTCATGTACCAGCTAGTTCATCCTCTTGGA
CGGCTCAAGGAGCTCCTCATCTACACTCCATTGGACCAGCCGCCCTACAGAGAACTGGAAAGGAATATCCGGTGG
CAATATGCGGAAGACGTCTTTCGCTCACTGGCAGCTGCGGAAGCGGACTCAAGCAAGGCTGAAGCCAAGTCTTTT
CCCACGATCCTTGAGAGCTGGGAGTGGAGTGGGAGGTTCATCGGCGGCTATGTTGCCGACTTGATGTCGGTGGCT
TCGATTCACGAAACACGGTCCTTCTCGTCTCTCACAAAGCTCAGCTTTACCAACTTTCAACTGCCATCCTTAGCC
AATGTGCGGCTCAGGCCAGATAGCGACGAGGAGGCGCTTCGAGCTGAACAAGAGGATGGCCAGGTGATTGAGGCC
GTTGCTCATGCCATCTCACGCTTGAAATACCTCGACCATCTGGTGTTTGAGTCTTCAACCGTATTGAATGACCGC
CTGCTCCCTCTGTTGCCCAAGAACCTCGCCCATCTAGAGCTCATCAACTGCTGGGAAGTCAACTCAAAGGATCTC
GCAGAATTCCTCATCACGCACGGCAGCAGGCTGCGAACCTTGAACCTGATGCACAACCAGTCCTTGGACCTGAGC
TTCTTGACCACCTTATCCGAAACGTGCCCCAACCTCCGAGAACTCCGCATCAACATGTCGTACTACCGTCACCAT
GAAAGCTTCAACGATTCGGATCCCATGTACGAATGGGCCCTTCTCCCGACCCAAGTCCCGCAATGGCCGCCCAGC
CTCAGGGTGATAAGCATCGAGCACATACGCAACTGGACCGTCGAGGCCGCAGAGGTCTTATTCCAATCTCTCATC
AACAGCGCCCCGAGATTACCCTGCCTCCGTCACCTCTCTATCAAGACCAGACTCGACATACCCTGGCAAGTCCGT
GCGACGATGCGTCGCGAATGGCGCGCCACCATGGAAACAGTCTTCCTCCGTCCCACCGCCTGCCCCCGGCCGCAC
ACGAGCCTTCACACGCCAATAACGAACGACGTCCAACCGCCGCGAGCTCCCAAGAGGCGTCGCACGACGGCAACC
AGCCCTCCCTCTCGCCGGAGCGGGAGGATCGCAGCCGCCAACGTCGGCAGTCGCATCTCGTCAAGCAAACGTCTC
CGCCGCCGCCAACAGGCAAGACCCTCGTACAAGGATCCGGATACGGACGAAGATGAGGCCTACGAGGAAGACACC
GATGATGAAGACGCCCAGAACGTCTCTTCCGCCGACTCGGCCGACGGAGAAACTGGCCCGACCATCCAGGGCCTT
TGCGAAACCGTCAACCTCCAATTCGACAACCAAAAGGTCCGCGAACTGCAGTGGGGCATGGAAGACTTTCTCGAC
CTCGACGACAAGGTCGAGTCGGAGGATGAATGGGAGGGAGACGAGGACTAA
Gene >Ophcf2|04298
ATGTCAAAGTCTGGAATGGTGGCCACCCGCAAATCGGCACGGACCGACATCCGGAGTGCTCACCGCCGGAAGTCT
GGGCCTGTTTCTCGCCGGCGTCGACGAGCATCACCATCTTCTTCCAATAACGATGACCAAGGAAGCGATTTTCAT
CCTGAAGACGACGCACCCTATCCGGGCCGCAAAGAGAATAAACGCGGCAGAAAACGTCGCGCGCCTCTAACAGAT
GTCGACTCTAATGACACGGTTTTGTCCCTGTCGGAGCCGTCTCGACGAGGCTCTCAGGAACCGCGAGCCAAGAGT
CGCCAGCCGGCTACGCTTCCAGACGACCATGAACCAACCAGTCTGATCCCGAACTGGAAGGATGCGCGCATCACT
TTTGACTGCTGGACAAACATATTTTTTTTCGCCGCGACCTCAGCATCGGTCGACGGCCTTTCCACAGGCTGGCTC
GTTCAAGCCGCCACTTCATGTCAAGCTTTTGCCGAGCCGGCTCTGACGGCGCTCTACCGATGTCCTCCAATAAAA
AACACCTTGAAAGCCAAGCGTCTCGCCGCCTTGCTCGATCGCCCCCCTTCGGAAACCCTCTTTAATTACCGAGTC
AAGGTCGAGGCCCTGTACATCAACGTTCACATCGTCCCCCAGACCCTCATGTACCAGCTAGTTCATCCTCTTGGA
CGGCTCAAGGAGCTCCTCATCTACACTCCATTGGACCAGCCGCCCTACAGAGAACTGGAAAGGAATATCCGGTGG
CAATATGCGGAAGACGTCTTTCGCTCACTGGCAGCTGCGGAAGCGGACTCAAGCAAGGCTGAAGCCAAGTCTTTT
CCCACGATCCTTGAGAGCTGGGAGTGGAGTGGGAGGTTCATCGGCGGCTATGTTGCCGACTTGATGTCGGTGGCT
TCGATTCACGAAACACGGTCCTTCTCGTCTCTCACAAAGCTCAGCTTTACCAACTTTCAACTGCCATCCTTAGCC
AATGTGCGGCTCAGGCCAGATAGCGACGAGGAGGCGCTTCGAGCTGAACAAGAGGATGGCCAGGTGATTGAGGCC
GTTGCTCATGCCATCTCACGCTTGAAATACCTCGACCATCTGGTGTTTGAGTCTTCAACCGTATTGAATGACCGC
CTGCTCCCTCTGTTGCCCAAGAACCTCGCCCATCTAGAGCTCATCAACTGCTGGGAAGTCAACTCAAAGGATCTC
GCAGAATTCCTCATCACGCACGGCAGCAGGCTGCGAACCTTGAACCTGATGCACAACCAGTCCTTGGACCTGAGC
TTCTTGACCACCTTATCCGAAACGTGCCCCAACCTCCGAGAACTCCGCATCAACATGTCGTACTACCGTCACCAT
GAAAGCTTCAACGATTCGGATCCCATGTACGAATGGGCCCTTCTCCCGACCCAAGTCCCGCAATGGCCGCCCAGC
CTCAGGGTGATAAGCATCGAGCACATACGCAACTGGACCGTCGAGGCCGCAGAGGTCTTATTCCAATCTCTCATC
AACAGCGCCCCGAGATTACCCTGCCTCCGTCACCTCTCTATCAAGACCAGACTCGACATACCCTGGCAAGTCCGT
GCGACGATGCGTCGCGAATGGCGCGCCACCATGGAAACAGTCTTCCTCCGTCCCACCGCCTGCCCCCGGCCGCAC
ACGAGCCTTCACACGCCAATAACGAACGACGTCCAACCGCCGCGAGCTCCCAAGAGGCGTCGCACGACGGCAACC
AGCCCTCCCTCTCGCCGGAGCGGGAGGATCGCAGCCGCCAACGTCGGCAGTCGCATCTCGTCAAGCAAACGTCTC
CGCCGCCGCCAACAGGCAAGACCCTCGTACAAGGATCCGGATACGGACGAAGATGAGGCCTACGAGGAAGACACC
GATGATGAAGACGCCCAGAACGTCTCTTCCGCCGACTCGGCCGACGGAGAAACTGGCCCGACCATCCAGGGCCTT
TGCGAAACCGTCAACCTCCAATTCGACAACCAAAAGGTCCGCGAACTGCAGTGGGGCATGGAAGACTTTCTCGAC
CTCGACGACAAGGTCGAGTCGGAGGATGAATGGGAGGGAGACGAGGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail