Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04297
Gene name
Locationscaffold_04:2852811..2855025
Strand-
Gene length (bp)2214
Transcript length (bp)2109
Coding sequence length (bp)2109
Protein length (aa) 703

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09733 VEFS-Box VEFS-Box of polycomb protein 1.9E-05 498 593

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2287 0.9245 0.044 0.0203 0.0674 0.0051 0.0315 0.0135 0.0281 0.0024

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2448
Ophiocordyceps australis map64 (Brazil) OphauB2|2517
Ophiocordyceps camponoti-floridani Ophcf2|04297 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2114
Ophiocordyceps kimflemingae Ophio5|1392
Ophiocordyceps subramaniannii Hirsu2|2172

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04297
MGNITSSAVKGPLPRHTDGPSPAKRRRFTSPDSFELDRLLAAPQMAELGSALCIEVLKIFHKDSKKVRSMQTSNI
PHDFTITKARCRITIFDTSSDQPLVLDRQSKLCDLVTFKNPVGPHRVARIDLPRPFVVPHESILVNRPEDGRLDL
SDSYQLLVELEAANGSRWPPLDTNDFGLSSAMPFTQADSTQHWILSSRFDSVVGRLKNSLDLAARLSPQQPPYET
DYVMDVDLRWSAGLKALKHADKDSKPCITAIDPEVHSCRFADFQGPNGHGNGNGETSVEPDDESVLGNTPSRSLR
TREKEKVYNLKVLSDQAHGRDRTKGGRSGSVTTTVEGCVQYLLPADQPVCLDYFRCVSCGAIHESMAELQTHLRT
VHIAFDYVFESTSQGPQFQVSARRETSIKPHGRGHQVRPFHLYTHDQVCVTSRPALENETNSNLSPSRPERLQSG
SPAIKGSKPLAQRRPRKQKVIKAVVPDIPQPLYHPISRARLNPGDEVPETEPDNTWLIQRHRESIAEFSDVTPAE
KEYIWEWDGYILGKNLTSLAYFPREWLGFVREKATWLVSEKRRMLEFGKHSSALLARNLLNDTMMEDAFAMIDKA
RAALKQQARQDEVDEQQQPAAGVPSPRQSPKVRKSASGCVVCQLPVLGPTMLICSNTSCSKRLYHSTCIEKSILP
IPRAKWLCATVIKKASSRSKGKAPAPA*
Coding >Ophcf2|04297
ATGGGCAATATCACATCGTCCGCCGTCAAGGGTCCGTTGCCACGCCACACGGATGGCCCTAGCCCGGCCAAGCGC
CGCCGCTTCACGTCGCCCGACTCATTCGAGCTGGACCGTCTGCTCGCGGCCCCTCAGATGGCCGAACTAGGCTCG
GCTCTGTGCATTGAGGTGCTCAAGATTTTTCACAAGGACTCCAAAAAGGTCAGGTCGATGCAGACCTCCAACATC
CCCCACGACTTCACCATCACCAAGGCCCGCTGCAGAATCACAATTTTCGACACCAGCTCCGATCAGCCCCTGGTC
CTTGACCGCCAGAGCAAGCTCTGCGACTTGGTAACTTTCAAAAATCCCGTGGGCCCTCATCGCGTCGCCCGCATT
GATCTGCCGCGCCCTTTCGTCGTTCCCCATGAGAGCATCCTCGTCAACAGGCCCGAAGATGGCAGGCTTGATCTA
TCCGACTCGTATCAGCTCCTGGTCGAGCTGGAAGCCGCCAACGGAAGTCGCTGGCCTCCCCTCGACACCAATGAT
TTCGGCCTCTCATCCGCAATGCCTTTTACCCAGGCAGATTCCACCCAGCATTGGATCTTATCCAGCCGCTTCGAC
AGCGTCGTCGGCAGGCTAAAGAACTCGCTCGATCTGGCGGCCAGGCTGTCCCCGCAACAGCCACCTTACGAGACT
GATTATGTCATGGACGTTGACCTTCGATGGTCGGCTGGTCTTAAAGCGCTCAAGCATGCCGACAAGGACTCGAAA
CCGTGCATTACGGCTATCGATCCCGAGGTCCATTCCTGTCGTTTTGCAGATTTTCAAGGTCCCAACGGCCATGGG
AATGGCAATGGTGAAACCTCTGTCGAACCAGATGATGAGTCGGTACTTGGAAATACGCCGTCTCGCTCATTAAGG
ACTCGAGAAAAGGAAAAGGTCTACAATTTGAAAGTCTTGAGTGACCAGGCACACGGCAGAGACCGGACAAAAGGC
GGGAGAAGCGGCAGCGTGACGACGACTGTCGAGGGTTGCGTTCAGTATCTCTTGCCGGCCGATCAGCCCGTCTGC
CTCGACTATTTCCGCTGCGTCAGCTGCGGTGCGATTCACGAGTCCATGGCCGAGCTGCAGACTCATCTCCGCACC
GTCCACATAGCATTCGACTATGTTTTCGAGTCGACGAGTCAGGGGCCGCAGTTTCAAGTCTCTGCTCGGCGTGAA
ACTTCCATCAAGCCGCACGGCCGTGGACACCAAGTGCGGCCCTTTCACCTCTATACCCACGATCAGGTTTGCGTG
ACGTCGCGTCCTGCCTTGGAAAATGAAACCAACAGCAACTTGTCTCCGTCCAGGCCCGAGCGACTGCAGTCTGGA
TCGCCGGCCATCAAGGGTTCAAAGCCCCTGGCACAGCGTCGTCCGCGAAAACAAAAGGTTATCAAGGCCGTGGTG
CCAGATATACCTCAGCCGCTTTATCATCCTATTAGCAGGGCGCGCCTGAACCCCGGCGATGAGGTGCCAGAGACG
GAGCCGGACAACACGTGGCTTATTCAGAGGCACCGAGAAAGCATAGCCGAATTCTCTGACGTGACGCCGGCCGAG
AAGGAGTACATTTGGGAGTGGGACGGTTACATCCTCGGCAAGAACCTCACATCGCTCGCCTACTTCCCGCGTGAG
TGGCTCGGCTTCGTGCGAGAAAAGGCGACGTGGCTCGTGTCGGAAAAGCGACGGATGCTCGAGTTCGGGAAGCAC
TCGAGCGCTTTGCTCGCCCGCAACCTCTTGAACGACACGATGATGGAGGACGCGTTCGCCATGATCGATAAAGCG
AGAGCCGCGCTGAAGCAGCAGGCCCGCCAAGACGAAGTAGACGAGCAGCAGCAGCCGGCAGCCGGCGTCCCGAGC
CCAAGACAGTCACCCAAGGTTCGCAAGAGCGCCAGCGGCTGCGTTGTGTGTCAGTTGCCGGTTCTCGGCCCGACG
ATGTTGATATGCTCCAATACGTCGTGCTCGAAACGTCTCTATCATTCTACTTGCATCGAAAAGTCCATCCTGCCG
ATCCCTCGAGCGAAATGGCTTTGCGCGACAGTAATCAAGAAGGCTTCCTCGAGGTCCAAGGGTAAAGCTCCGGCG
CCGGCTTGA
Transcript >Ophcf2|04297
ATGGGCAATATCACATCGTCCGCCGTCAAGGGTCCGTTGCCACGCCACACGGATGGCCCTAGCCCGGCCAAGCGC
CGCCGCTTCACGTCGCCCGACTCATTCGAGCTGGACCGTCTGCTCGCGGCCCCTCAGATGGCCGAACTAGGCTCG
GCTCTGTGCATTGAGGTGCTCAAGATTTTTCACAAGGACTCCAAAAAGGTCAGGTCGATGCAGACCTCCAACATC
CCCCACGACTTCACCATCACCAAGGCCCGCTGCAGAATCACAATTTTCGACACCAGCTCCGATCAGCCCCTGGTC
CTTGACCGCCAGAGCAAGCTCTGCGACTTGGTAACTTTCAAAAATCCCGTGGGCCCTCATCGCGTCGCCCGCATT
GATCTGCCGCGCCCTTTCGTCGTTCCCCATGAGAGCATCCTCGTCAACAGGCCCGAAGATGGCAGGCTTGATCTA
TCCGACTCGTATCAGCTCCTGGTCGAGCTGGAAGCCGCCAACGGAAGTCGCTGGCCTCCCCTCGACACCAATGAT
TTCGGCCTCTCATCCGCAATGCCTTTTACCCAGGCAGATTCCACCCAGCATTGGATCTTATCCAGCCGCTTCGAC
AGCGTCGTCGGCAGGCTAAAGAACTCGCTCGATCTGGCGGCCAGGCTGTCCCCGCAACAGCCACCTTACGAGACT
GATTATGTCATGGACGTTGACCTTCGATGGTCGGCTGGTCTTAAAGCGCTCAAGCATGCCGACAAGGACTCGAAA
CCGTGCATTACGGCTATCGATCCCGAGGTCCATTCCTGTCGTTTTGCAGATTTTCAAGGTCCCAACGGCCATGGG
AATGGCAATGGTGAAACCTCTGTCGAACCAGATGATGAGTCGGTACTTGGAAATACGCCGTCTCGCTCATTAAGG
ACTCGAGAAAAGGAAAAGGTCTACAATTTGAAAGTCTTGAGTGACCAGGCACACGGCAGAGACCGGACAAAAGGC
GGGAGAAGCGGCAGCGTGACGACGACTGTCGAGGGTTGCGTTCAGTATCTCTTGCCGGCCGATCAGCCCGTCTGC
CTCGACTATTTCCGCTGCGTCAGCTGCGGTGCGATTCACGAGTCCATGGCCGAGCTGCAGACTCATCTCCGCACC
GTCCACATAGCATTCGACTATGTTTTCGAGTCGACGAGTCAGGGGCCGCAGTTTCAAGTCTCTGCTCGGCGTGAA
ACTTCCATCAAGCCGCACGGCCGTGGACACCAAGTGCGGCCCTTTCACCTCTATACCCACGATCAGGTTTGCGTG
ACGTCGCGTCCTGCCTTGGAAAATGAAACCAACAGCAACTTGTCTCCGTCCAGGCCCGAGCGACTGCAGTCTGGA
TCGCCGGCCATCAAGGGTTCAAAGCCCCTGGCACAGCGTCGTCCGCGAAAACAAAAGGTTATCAAGGCCGTGGTG
CCAGATATACCTCAGCCGCTTTATCATCCTATTAGCAGGGCGCGCCTGAACCCCGGCGATGAGGTGCCAGAGACG
GAGCCGGACAACACGTGGCTTATTCAGAGGCACCGAGAAAGCATAGCCGAATTCTCTGACGTGACGCCGGCCGAG
AAGGAGTACATTTGGGAGTGGGACGGTTACATCCTCGGCAAGAACCTCACATCGCTCGCCTACTTCCCGCGTGAG
TGGCTCGGCTTCGTGCGAGAAAAGGCGACGTGGCTCGTGTCGGAAAAGCGACGGATGCTCGAGTTCGGGAAGCAC
TCGAGCGCTTTGCTCGCCCGCAACCTCTTGAACGACACGATGATGGAGGACGCGTTCGCCATGATCGATAAAGCG
AGAGCCGCGCTGAAGCAGCAGGCCCGCCAAGACGAAGTAGACGAGCAGCAGCAGCCGGCAGCCGGCGTCCCGAGC
CCAAGACAGTCACCCAAGGTTCGCAAGAGCGCCAGCGGCTGCGTTGTGTGTCAGTTGCCGGTTCTCGGCCCGACG
ATGTTGATATGCTCCAATACGTCGTGCTCGAAACGTCTCTATCATTCTACTTGCATCGAAAAGTCCATCCTGCCG
ATCCCTCGAGCGAAATGGCTTTGCGCGACAGTAATCAAGAAGGCTTCCTCGAGGTCCAAGGGTAAAGCTCCGGCG
CCGGCTTGA
Gene >Ophcf2|04297
ATGGGCAATATCACATCGTCCGCCGTCAAGGGTCCGTTGCCACGCCACACGGATGGCCCTAGCCCGGCCAAGCGC
CGCCGCTTCACGTCGCCCGACTCATTCGAGCTGGACCGTCTGCTCGCGGCCCCTCAGATGGCCGAACTAGGCTCG
GCTCTGTGCATTGAGGTGCTCAAGATTTTTCACAAGGACTCCAAAAAGGTCAGGTCGATGCAGACCTCCAACATC
CCCCACGACTTCACCATCACCAAGGCCCGCTGCAGAATCACAATTTTCGACACCAGCTCCGATCAGCCCCTGGTC
CTTGACCGCCAGAGCAAGCTCTGCGACTTGGTAACTTTCAAAAATCCCGTGGGCCCTCATCGCGTCGCCCGCATT
GATCTGCCGCGCCCTTTCGTCGTTCCCCATGAGAGCATCCTCGTCAACAGGCCCGAAGATGGCAGGCTTGATCTA
TCCGACTCGTATCAGCTCCTGGTCGAGCTGGAAGCCGCCAACGGAAGTCGCTGGCCTCCCCTCGACACCAATGAT
TTCGGCCTCTCATCCGCAATGCCTTTTACCCAGGCAGATTCCACCCAGCATTGGATCTTATCCAGCCGCTTCGAC
AGCGTCGTCGGCAGGCTAAAGAACTCGCTCGATCTGGCGGCCAGGCTGTCCCCGCAACAGCCACCTTACGAGACT
GATTATGTCATGGACGTTGACCTTCGATGGTCGGCTGGTCTTAAAGCGCTCAAGCATGCCGACAAGGACTCGAAA
CCGTGCATTACGGCTATCGATCCCGAGGTCCATTCCTGTCGTTTTGCAGATTTTCAAGGTCCCAACGGCCATGGG
AATGGCAATGGTGAAACCTCTGTCGAACCAGATGATGAGTCGGTACTTGGAAATACGCCGTCTCGCTCATTAAGG
ACTCGAGAAAAGGAAAAGGTCTACAATTTGAAAGTCTTGAGTGACCAGGCACACGGCAGAGACCGGACAAAAGGC
GGGAGAAGCGGCAGCGTGACGACGACTGTCGAGGGTTGCGTTCAGTATCTCTTGCCGGCCGATCAGCCCGTCTGC
CTCGACTATTTCCGCTGCGTCAGCTGCGGTGCGATTCACGAGTCCATGGCCGAGCTGCAGACTCATCTCCGCACC
GTCCACATAGCATTCGACTATGTTTTCGAGTCGACGAGTCAGGGGCCGCAGTTTCAAGTCTCTGCTCGGCGTGAA
ACTTCCATCAAGCCGCACGGCCGTGGACACCAAGTGCGGCCCTTTCACCTCTATACCCACGATCAGGTTTGCGTG
ACGTCGCGTCCTGCCTTGGAAAATGAAACCAACAGCAACTTGTCTCCGTCCAGGCCCGAGCGACTGCAGTCTGGA
TCGCCGGCCATCAAGGGTTCAAAGCCCCTGGCACAGCGTCGTCCGCGAAAACAAAAGGTTATCAAGGCCGTGGTG
CCAGATATACCTCAGCCGCTTTATCATCCTATTAGCAGGGCGCGCCTGAACCCCGGCGATGAGGTGCCAGAGACG
GAGCCGGACAACACGTGGCTTATTCAGAGGCACCGAGAAAGCATAGCCGAATTCTCTGACGTGACGCCGGCCGAG
AAGGAGTACATTTGGGAGTGGGACGGTTACATCCTCGGCAAGAACCTCACATCGCTCGCCTACTTCCCGCGTGAG
TGGCTCGGCTTCGTGCGAGAAAAGGCGACGTGGCTCGTGTCGGAAAAGCGACGGATGCTCGAGTTCGGGAAGCAC
TCGAGCGCTTTGCTCGCCCGCAACCTCTTGAACGACACGATGATGGAGGACGCGTTCGCCATGATCGATAAAGCG
AGAGCCGCGCTGAAGCAGCAGGCCCGCCAAGACGAAGTAGACGAGCAGCAGCAGCCGGCAGCCGGCGTCCCGAGC
CCAAGACAGTCACCCAAGGTTCGCAAGAGCGCCAGCGGCTGCGTTGTGTGTCAGTTGCCGGTTCTCGGCCCGACG
ATGTTGATATGCTCCAATACGGTGGGTATCTGTCTCGTGCCTTGCCTGCCTGAGAGTGTGCTGACGGGGTTTCTC
CCGCAGTCGTGCTCGAAACGTCTCTATCATTCTACTTGCATCGAAAAGTCCATCCTGCCGATCCCTCGAGCGAAA
TGGCTTTGCGGTGCTTGTTGTGGCATGAATGGGTCTAGCTGACCCTGTCTGAAAGCGACAGTAATCAAGAAGGCT
TCCTCGAGGTCCAAGGGTAAAGCTCCGGCGCCGGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail