Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04295
Gene name
Locationscaffold_04:2847821..2849471
Strand-
Gene length (bp)1650
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 3.0E-56 114 437

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 149 171 22
2 184 206 22
3 216 238 22
4 245 267 22
5 272 291 19
6 318 340 22
7 376 398 22
8 405 427 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 52.99 30.02 75.96
Alive In ants, during behavior modification 52.32 29.63 75.00
Dead In ants, recently dead 66.92 38.45 95.40

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.961630 no
Alive Dead 0.140716 no
Dead Fungus 0.232493 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04295
MEKFPDHIDSPSFVVQEASPPTPPGPPSKHHQAANGSANGVGNGFENPASSLLTDRWMPRRDEALASSLSAPRTG
RNRQKSLSDAFRTIRSRNGSVSQNAHEIADALRAPVSPKLVALCLLWYTSSALTNTSSKSILIAFDKPATLTLVQ
FAFVSSLCIILAWLASVFPVLPSTMAVLRHPIRRPSAHVISTTLPLAAFQIGGHLLSSTATAKIPVSLVHTIKGL
SPLFTVLAYRIFYDIKYPRATYFSLVPLTTGVMLACSGKVTYGGQLAGVLQALLATLIFVSQNIVSKKIFNEAAK
AEAEVPGTQSRKLDKLNLLCYSSGMAFVVTLPIWFWTEGIALVGDVLHDGAVDLSNHPLAMDHGRLTLEFIFNGV
FHFSQNMLAFVLLSMVSPVTYSVASLIKRVFVIVMAIVWFRSPTTPIQAVGIALTFLGLYLYDRSSESNKADRKA
RAIAHTRSATPLLPLDEKPARGNDGSPDPSANSSPHAYTEGYLGPTAASHDSKKSDVRVGRSRSGGSSTTSWLRG
Q*
Coding >Ophcf2|04295
ATGGAAAAGTTCCCCGATCACATCGATTCGCCGTCGTTTGTGGTGCAGGAAGCATCCCCGCCTACGCCTCCGGGT
CCTCCGTCGAAGCACCACCAGGCCGCCAATGGCAGCGCCAATGGTGTCGGGAACGGCTTCGAGAATCCCGCCTCG
TCGTTGCTGACAGATCGCTGGATGCCCAGACGAGATGAAGCGCTCGCCTCGTCTTTGTCTGCGCCGAGGACAGGT
CGCAATCGCCAGAAGAGCTTGAGCGATGCCTTTCGCACGATTCGGTCGAGGAACGGAAGCGTCAGCCAGAATGCC
CATGAAATTGCCGACGCGCTACGGGCTCCTGTGTCTCCCAAGCTCGTCGCCCTCTGCCTGCTCTGGTACACGTCC
TCGGCCCTGACAAACACGTCGTCCAAGTCGATCCTCATCGCCTTCGACAAGCCAGCCACCCTCACCCTCGTCCAA
TTCGCCTTCGTCTCCTCGCTCTGCATCATCCTCGCCTGGCTGGCCAGCGTCTTTCCCGTTCTGCCCTCCACGATG
GCCGTCCTCCGGCACCCAATTCGAAGGCCCAGTGCCCATGTCATCTCTACCACGCTTCCCCTCGCCGCCTTTCAG
ATCGGAGGCCACCTCTTGAGCTCGACGGCCACGGCCAAGATCCCCGTCTCCCTCGTCCACACCATCAAGGGCCTC
TCCCCTCTCTTCACCGTCTTGGCCTATAGAATATTCTACGATATCAAGTACCCCCGAGCCACCTACTTCTCTCTC
GTGCCCCTGACCACCGGCGTCATGCTCGCCTGCTCGGGCAAGGTCACGTACGGCGGTCAGTTGGCAGGCGTGCTT
CAGGCTCTTCTCGCCACGCTCATCTTTGTCTCGCAAAACATTGTGTCCAAGAAAATCTTCAACGAGGCCGCAAAA
GCCGAGGCCGAGGTTCCCGGCACGCAGTCGAGGAAACTAGACAAGCTCAACCTCTTATGCTACTCGTCTGGCATG
GCCTTTGTCGTCACCCTACCCATCTGGTTCTGGACAGAAGGTATCGCTCTCGTCGGAGACGTCCTGCACGACGGC
GCCGTCGACCTCAGCAACCACCCTCTGGCCATGGATCACGGCCGCCTAACTCTCGAGTTCATCTTCAACGGCGTC
TTCCACTTCAGCCAAAATATGCTAGCCTTTGTTCTCTTATCCATGGTCTCGCCCGTCACGTACTCCGTCGCCAGC
CTCATCAAGAGAGTCTTCGTCATCGTCATGGCCATCGTCTGGTTCAGGAGCCCGACGACTCCGATTCAAGCCGTC
GGCATCGCCCTCACCTTCCTCGGTCTGTATCTCTACGACCGTTCGAGTGAGAGCAACAAGGCCGACCGCAAGGCG
CGCGCCATAGCCCACACCCGCTCCGCCACGCCTCTCTTACCGCTCGACGAGAAGCCAGCCAGGGGCAACGACGGC
AGCCCCGACCCGTCAGCCAATTCAAGCCCGCACGCCTACACTGAAGGCTACTTGGGCCCGACCGCTGCCAGTCAC
GACTCCAAGAAGTCGGACGTCAGGGTCGGCCGCAGCCGTTCAGGGGGCAGCAGCACTACGAGCTGGTTGCGAGGC
CAATGA
Transcript >Ophcf2|04295
ATGGAAAAGTTCCCCGATCACATCGATTCGCCGTCGTTTGTGGTGCAGGAAGCATCCCCGCCTACGCCTCCGGGT
CCTCCGTCGAAGCACCACCAGGCCGCCAATGGCAGCGCCAATGGTGTCGGGAACGGCTTCGAGAATCCCGCCTCG
TCGTTGCTGACAGATCGCTGGATGCCCAGACGAGATGAAGCGCTCGCCTCGTCTTTGTCTGCGCCGAGGACAGGT
CGCAATCGCCAGAAGAGCTTGAGCGATGCCTTTCGCACGATTCGGTCGAGGAACGGAAGCGTCAGCCAGAATGCC
CATGAAATTGCCGACGCGCTACGGGCTCCTGTGTCTCCCAAGCTCGTCGCCCTCTGCCTGCTCTGGTACACGTCC
TCGGCCCTGACAAACACGTCGTCCAAGTCGATCCTCATCGCCTTCGACAAGCCAGCCACCCTCACCCTCGTCCAA
TTCGCCTTCGTCTCCTCGCTCTGCATCATCCTCGCCTGGCTGGCCAGCGTCTTTCCCGTTCTGCCCTCCACGATG
GCCGTCCTCCGGCACCCAATTCGAAGGCCCAGTGCCCATGTCATCTCTACCACGCTTCCCCTCGCCGCCTTTCAG
ATCGGAGGCCACCTCTTGAGCTCGACGGCCACGGCCAAGATCCCCGTCTCCCTCGTCCACACCATCAAGGGCCTC
TCCCCTCTCTTCACCGTCTTGGCCTATAGAATATTCTACGATATCAAGTACCCCCGAGCCACCTACTTCTCTCTC
GTGCCCCTGACCACCGGCGTCATGCTCGCCTGCTCGGGCAAGGTCACGTACGGCGGTCAGTTGGCAGGCGTGCTT
CAGGCTCTTCTCGCCACGCTCATCTTTGTCTCGCAAAACATTGTGTCCAAGAAAATCTTCAACGAGGCCGCAAAA
GCCGAGGCCGAGGTTCCCGGCACGCAGTCGAGGAAACTAGACAAGCTCAACCTCTTATGCTACTCGTCTGGCATG
GCCTTTGTCGTCACCCTACCCATCTGGTTCTGGACAGAAGGTATCGCTCTCGTCGGAGACGTCCTGCACGACGGC
GCCGTCGACCTCAGCAACCACCCTCTGGCCATGGATCACGGCCGCCTAACTCTCGAGTTCATCTTCAACGGCGTC
TTCCACTTCAGCCAAAATATGCTAGCCTTTGTTCTCTTATCCATGGTCTCGCCCGTCACGTACTCCGTCGCCAGC
CTCATCAAGAGAGTCTTCGTCATCGTCATGGCCATCGTCTGGTTCAGGAGCCCGACGACTCCGATTCAAGCCGTC
GGCATCGCCCTCACCTTCCTCGGTCTGTATCTCTACGACCGTTCGAGTGAGAGCAACAAGGCCGACCGCAAGGCG
CGCGCCATAGCCCACACCCGCTCCGCCACGCCTCTCTTACCGCTCGACGAGAAGCCAGCCAGGGGCAACGACGGC
AGCCCCGACCCGTCAGCCAATTCAAGCCCGCACGCCTACACTGAAGGCTACTTGGGCCCGACCGCTGCCAGTCAC
GACTCCAAGAAGTCGGACGTCAGGGTCGGCCGCAGCCGTTCAGGGGGCAGCAGCACTACGAGCTGGTTGCGAGGC
CAATGA
Gene >Ophcf2|04295
ATGGAAAAGTTCCCCGATCACATCGATTCGCCGTCGTTTGTGGTGCAGGAAGCATCCCCGCCTACGCCTCCGGGT
CCTCCGTCGAAGCACCACCAGGCCGCCAATGGCAGCGCCAATGGTGTCGGGAACGGCTTCGAGAATCCCGCCTCG
TCGTTGCTGACAGATCGCTGGATGCCCAGACGAGATGAAGCGCTCGCCTCGTCTTTGTCTGCGCCGAGGACAGGT
CGCAATCGCCAGAAGAGCTTGAGCGATGCCTTTCGCACGATTCGGTCGAGGAACGGAAGCGTCAGCCAGAATGCC
CATGAAATTGCCGACGCGCTACGGGCTCCTGTGTCTCCCAAGCTCGTCGTGCGTCATTGATCCATCCATCCACTC
ATTTCCTCATCGCTTCAGTCGCTGACGACGGCCTAAAAAAAGGCCCTCTGCCTGCTCTGGTACACGTCCTCGGCC
CTGACAAACACGTCGTCCAAGTCGATCCTCATCGCCTTCGACAAGCCAGCCACCCTCACCCTCGTCCAATTCGCC
TTCGTCTCCTCGCTCTGCATCATCCTCGCCTGGCTGGCCAGCGTCTTTCCCGTTCTGCCCTCCACGATGGCCGTC
CTCCGGCACCCAATTCGAAGGCCCAGTGCCCATGTCATCTCTACCACGCTTCCCCTCGCCGCCTTTCAGATCGGA
GGCCACCTCTTGAGCTCGACGGCCACGGCCAAGATCCCCGTCTCCCTCGTCCACACCATCAAGGGCCTCTCCCCT
CTCTTCACCGTCTTGGCCTATAGAATATTCTACGATATCAAGTACCCCCGAGCCACCTACTTCTCTCTCGTGCCC
CTGACCACCGGCGTCATGCTCGCCTGCTCGGGCAAGGTCACGTACGGCGGTCAGTTGGCAGGCGTGCTTCAGGCT
CTTCTCGCCACGCTCATCTTTGTCTCGCAAAACATTGTGTCCAAGAAAATCTTCAACGAGGCCGCAAAAGCCGAG
GCCGAGGTTCCCGGCACGCAGTCGAGGAAACTAGACAAGCTCAACCTCTTATGCTACTCGTCTGGCATGGCCTTT
GTCGTCACCCTACCCATCTGGTTCTGGACAGAAGGTATCGCTCTCGTCGGAGACGTCCTGCACGACGGCGCCGTC
GACCTCAGCAACCACCCTCTGGCCATGGATCACGGCCGCCTAACTCTCGAGTTCATCTTCAACGGCGTCTTCCAC
TTCAGCCAAAATATGCTAGCCTTTGTTCTCTTATCCATGGTCTCGCCCGTCACGTACTCCGTCGCCAGCCTCATC
AAGAGAGTCTTCGTCATCGTCATGGCCATCGTCTGGTTCAGGAGCCCGACGACTCCGATTCAAGCCGTCGGCATC
GCCCTCACCTTCCTCGGTCTGTATCTCTACGACCGTTCGAGTGAGAGCAACAAGGCCGACCGCAAGGCGCGCGCC
ATAGCCCACACCCGCTCCGCCACGCCTCTCTTACCGCTCGACGAGAAGCCAGCCAGGGGCAACGACGGCAGCCCC
GACCCGTCAGCCAATTCAAGCCCGCACGCCTACACTGAAGGCTACTTGGGCCCGACCGCTGCCAGTCACGACTCC
AAGAAGTCGGACGTCAGGGTCGGCCGCAGCCGTTCAGGGGGCAGCAGCACTACGAGCTGGTTGCGAGGCCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail