Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04295
Gene name
Locationscaffold_04:2847821..2849471
Strand-
Gene length (bp)1650
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 3.0E-56 114 437

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 149 171 22
2 184 206 22
3 216 238 22
4 245 267 22
5 272 291 19
6 318 340 22
7 376 398 22
8 405 427 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04295
MEKFPDHIDSPSFVVQEASPPTPPGPPSKHHQAANGSANGVGNGFENPASSLLTDRWMPRRDEALASSLSAPRTG
RNRQKSLSDAFRTIRSRNGSVSQNAHEIADALRAPVSPKLVALCLLWYTSSALTNTSSKSILIAFDKPATLTLVQ
FAFVSSLCIILAWLASVFPVLPSTMAVLRHPIRRPSAHVISTTLPLAAFQIGGHLLSSTATAKIPVSLVHTIKGL
SPLFTVLAYRIFYDIKYPRATYFSLVPLTTGVMLACSGKVTYGGQLAGVLQALLATLIFVSQNIVSKKIFNEAAK
AEAEVPGTQSRKLDKLNLLCYSSGMAFVVTLPIWFWTEGIALVGDVLHDGAVDLSNHPLAMDHGRLTLEFIFNGV
FHFSQNMLAFVLLSMVSPVTYSVASLIKRVFVIVMAIVWFRSPTTPIQAVGIALTFLGLYLYDRSSESNKADRKA
RAIAHTRSATPLLPLDEKPARGNDGSPDPSANSSPHAYTEGYLGPTAASHDSKKSDVRVGRSRSGGSSTTSWLRG
Q*
Coding >Ophcf2|04295
ATGGAAAAGTTCCCCGATCACATCGATTCGCCGTCGTTTGTGGTGCAGGAAGCATCCCCGCCTACGCCTCCGGGT
CCTCCGTCGAAGCACCACCAGGCCGCCAATGGCAGCGCCAATGGTGTCGGGAACGGCTTCGAGAATCCCGCCTCG
TCGTTGCTGACAGATCGCTGGATGCCCAGACGAGATGAAGCGCTCGCCTCGTCTTTGTCTGCGCCGAGGACAGGT
CGCAATCGCCAGAAGAGCTTGAGCGATGCCTTTCGCACGATTCGGTCGAGGAACGGAAGCGTCAGCCAGAATGCC
CATGAAATTGCCGACGCGCTACGGGCTCCTGTGTCTCCCAAGCTCGTCGCCCTCTGCCTGCTCTGGTACACGTCC
TCGGCCCTGACAAACACGTCGTCCAAGTCGATCCTCATCGCCTTCGACAAGCCAGCCACCCTCACCCTCGTCCAA
TTCGCCTTCGTCTCCTCGCTCTGCATCATCCTCGCCTGGCTGGCCAGCGTCTTTCCCGTTCTGCCCTCCACGATG
GCCGTCCTCCGGCACCCAATTCGAAGGCCCAGTGCCCATGTCATCTCTACCACGCTTCCCCTCGCCGCCTTTCAG
ATCGGAGGCCACCTCTTGAGCTCGACGGCCACGGCCAAGATCCCCGTCTCCCTCGTCCACACCATCAAGGGCCTC
TCCCCTCTCTTCACCGTCTTGGCCTATAGAATATTCTACGATATCAAGTACCCCCGAGCCACCTACTTCTCTCTC
GTGCCCCTGACCACCGGCGTCATGCTCGCCTGCTCGGGCAAGGTCACGTACGGCGGTCAGTTGGCAGGCGTGCTT
CAGGCTCTTCTCGCCACGCTCATCTTTGTCTCGCAAAACATTGTGTCCAAGAAAATCTTCAACGAGGCCGCAAAA
GCCGAGGCCGAGGTTCCCGGCACGCAGTCGAGGAAACTAGACAAGCTCAACCTCTTATGCTACTCGTCTGGCATG
GCCTTTGTCGTCACCCTACCCATCTGGTTCTGGACAGAAGGTATCGCTCTCGTCGGAGACGTCCTGCACGACGGC
GCCGTCGACCTCAGCAACCACCCTCTGGCCATGGATCACGGCCGCCTAACTCTCGAGTTCATCTTCAACGGCGTC
TTCCACTTCAGCCAAAATATGCTAGCCTTTGTTCTCTTATCCATGGTCTCGCCCGTCACGTACTCCGTCGCCAGC
CTCATCAAGAGAGTCTTCGTCATCGTCATGGCCATCGTCTGGTTCAGGAGCCCGACGACTCCGATTCAAGCCGTC
GGCATCGCCCTCACCTTCCTCGGTCTGTATCTCTACGACCGTTCGAGTGAGAGCAACAAGGCCGACCGCAAGGCG
CGCGCCATAGCCCACACCCGCTCCGCCACGCCTCTCTTACCGCTCGACGAGAAGCCAGCCAGGGGCAACGACGGC
AGCCCCGACCCGTCAGCCAATTCAAGCCCGCACGCCTACACTGAAGGCTACTTGGGCCCGACCGCTGCCAGTCAC
GACTCCAAGAAGTCGGACGTCAGGGTCGGCCGCAGCCGTTCAGGGGGCAGCAGCACTACGAGCTGGTTGCGAGGC
CAATGA
Transcript >Ophcf2|04295
ATGGAAAAGTTCCCCGATCACATCGATTCGCCGTCGTTTGTGGTGCAGGAAGCATCCCCGCCTACGCCTCCGGGT
CCTCCGTCGAAGCACCACCAGGCCGCCAATGGCAGCGCCAATGGTGTCGGGAACGGCTTCGAGAATCCCGCCTCG
TCGTTGCTGACAGATCGCTGGATGCCCAGACGAGATGAAGCGCTCGCCTCGTCTTTGTCTGCGCCGAGGACAGGT
CGCAATCGCCAGAAGAGCTTGAGCGATGCCTTTCGCACGATTCGGTCGAGGAACGGAAGCGTCAGCCAGAATGCC
CATGAAATTGCCGACGCGCTACGGGCTCCTGTGTCTCCCAAGCTCGTCGCCCTCTGCCTGCTCTGGTACACGTCC
TCGGCCCTGACAAACACGTCGTCCAAGTCGATCCTCATCGCCTTCGACAAGCCAGCCACCCTCACCCTCGTCCAA
TTCGCCTTCGTCTCCTCGCTCTGCATCATCCTCGCCTGGCTGGCCAGCGTCTTTCCCGTTCTGCCCTCCACGATG
GCCGTCCTCCGGCACCCAATTCGAAGGCCCAGTGCCCATGTCATCTCTACCACGCTTCCCCTCGCCGCCTTTCAG
ATCGGAGGCCACCTCTTGAGCTCGACGGCCACGGCCAAGATCCCCGTCTCCCTCGTCCACACCATCAAGGGCCTC
TCCCCTCTCTTCACCGTCTTGGCCTATAGAATATTCTACGATATCAAGTACCCCCGAGCCACCTACTTCTCTCTC
GTGCCCCTGACCACCGGCGTCATGCTCGCCTGCTCGGGCAAGGTCACGTACGGCGGTCAGTTGGCAGGCGTGCTT
CAGGCTCTTCTCGCCACGCTCATCTTTGTCTCGCAAAACATTGTGTCCAAGAAAATCTTCAACGAGGCCGCAAAA
GCCGAGGCCGAGGTTCCCGGCACGCAGTCGAGGAAACTAGACAAGCTCAACCTCTTATGCTACTCGTCTGGCATG
GCCTTTGTCGTCACCCTACCCATCTGGTTCTGGACAGAAGGTATCGCTCTCGTCGGAGACGTCCTGCACGACGGC
GCCGTCGACCTCAGCAACCACCCTCTGGCCATGGATCACGGCCGCCTAACTCTCGAGTTCATCTTCAACGGCGTC
TTCCACTTCAGCCAAAATATGCTAGCCTTTGTTCTCTTATCCATGGTCTCGCCCGTCACGTACTCCGTCGCCAGC
CTCATCAAGAGAGTCTTCGTCATCGTCATGGCCATCGTCTGGTTCAGGAGCCCGACGACTCCGATTCAAGCCGTC
GGCATCGCCCTCACCTTCCTCGGTCTGTATCTCTACGACCGTTCGAGTGAGAGCAACAAGGCCGACCGCAAGGCG
CGCGCCATAGCCCACACCCGCTCCGCCACGCCTCTCTTACCGCTCGACGAGAAGCCAGCCAGGGGCAACGACGGC
AGCCCCGACCCGTCAGCCAATTCAAGCCCGCACGCCTACACTGAAGGCTACTTGGGCCCGACCGCTGCCAGTCAC
GACTCCAAGAAGTCGGACGTCAGGGTCGGCCGCAGCCGTTCAGGGGGCAGCAGCACTACGAGCTGGTTGCGAGGC
CAATGA
Gene >Ophcf2|04295
ATGGAAAAGTTCCCCGATCACATCGATTCGCCGTCGTTTGTGGTGCAGGAAGCATCCCCGCCTACGCCTCCGGGT
CCTCCGTCGAAGCACCACCAGGCCGCCAATGGCAGCGCCAATGGTGTCGGGAACGGCTTCGAGAATCCCGCCTCG
TCGTTGCTGACAGATCGCTGGATGCCCAGACGAGATGAAGCGCTCGCCTCGTCTTTGTCTGCGCCGAGGACAGGT
CGCAATCGCCAGAAGAGCTTGAGCGATGCCTTTCGCACGATTCGGTCGAGGAACGGAAGCGTCAGCCAGAATGCC
CATGAAATTGCCGACGCGCTACGGGCTCCTGTGTCTCCCAAGCTCGTCGTGCGTCATTGATCCATCCATCCACTC
ATTTCCTCATCGCTTCAGTCGCTGACGACGGCCTAAAAAAAGGCCCTCTGCCTGCTCTGGTACACGTCCTCGGCC
CTGACAAACACGTCGTCCAAGTCGATCCTCATCGCCTTCGACAAGCCAGCCACCCTCACCCTCGTCCAATTCGCC
TTCGTCTCCTCGCTCTGCATCATCCTCGCCTGGCTGGCCAGCGTCTTTCCCGTTCTGCCCTCCACGATGGCCGTC
CTCCGGCACCCAATTCGAAGGCCCAGTGCCCATGTCATCTCTACCACGCTTCCCCTCGCCGCCTTTCAGATCGGA
GGCCACCTCTTGAGCTCGACGGCCACGGCCAAGATCCCCGTCTCCCTCGTCCACACCATCAAGGGCCTCTCCCCT
CTCTTCACCGTCTTGGCCTATAGAATATTCTACGATATCAAGTACCCCCGAGCCACCTACTTCTCTCTCGTGCCC
CTGACCACCGGCGTCATGCTCGCCTGCTCGGGCAAGGTCACGTACGGCGGTCAGTTGGCAGGCGTGCTTCAGGCT
CTTCTCGCCACGCTCATCTTTGTCTCGCAAAACATTGTGTCCAAGAAAATCTTCAACGAGGCCGCAAAAGCCGAG
GCCGAGGTTCCCGGCACGCAGTCGAGGAAACTAGACAAGCTCAACCTCTTATGCTACTCGTCTGGCATGGCCTTT
GTCGTCACCCTACCCATCTGGTTCTGGACAGAAGGTATCGCTCTCGTCGGAGACGTCCTGCACGACGGCGCCGTC
GACCTCAGCAACCACCCTCTGGCCATGGATCACGGCCGCCTAACTCTCGAGTTCATCTTCAACGGCGTCTTCCAC
TTCAGCCAAAATATGCTAGCCTTTGTTCTCTTATCCATGGTCTCGCCCGTCACGTACTCCGTCGCCAGCCTCATC
AAGAGAGTCTTCGTCATCGTCATGGCCATCGTCTGGTTCAGGAGCCCGACGACTCCGATTCAAGCCGTCGGCATC
GCCCTCACCTTCCTCGGTCTGTATCTCTACGACCGTTCGAGTGAGAGCAACAAGGCCGACCGCAAGGCGCGCGCC
ATAGCCCACACCCGCTCCGCCACGCCTCTCTTACCGCTCGACGAGAAGCCAGCCAGGGGCAACGACGGCAGCCCC
GACCCGTCAGCCAATTCAAGCCCGCACGCCTACACTGAAGGCTACTTGGGCCCGACCGCTGCCAGTCACGACTCC
AAGAAGTCGGACGTCAGGGTCGGCCGCAGCCGTTCAGGGGGCAGCAGCACTACGAGCTGGTTGCGAGGCCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail