Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04288
Gene name
Locationscaffold_04:2826090..2828973
Strand+
Gene length (bp)2883
Transcript length (bp)2376
Coding sequence length (bp)2376
Protein length (aa) 792

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06733 DEAD_2 DEAD_2 2.7E-54 71 255
PF06777 HBB Helical and beta-bridge domain 2.1E-45 269 412
PF13307 Helicase_C_2 Helicase C-terminal domain 3.9E-43 524 696

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0004386 helicase activity Yes
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides Yes
GO:0003678 DNA helicase activity Yes
GO:0006139 nucleobase-containing compound metabolic process Yes
GO:0003677 DNA binding Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0140657 ATP-dependent activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0044238 primary metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6295 0.7181 0.0187 0.1214 0.1443 0.008 0.0571 0.0516 0.0577 0.0024

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4926
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3327
Ophiocordyceps australis map64 (Brazil) OphauB2|2496
Ophiocordyceps camponoti-floridani Ophcf2|04288 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2107
Ophiocordyceps kimflemingae Ophio5|6514
Ophiocordyceps subramaniannii Hirsu2|1617

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04288
MKFEIEGLPVLFPYPRIYPEQYAYMCDLKKTLDAGGHCVLEMPSGTGKTVSLLSLIVAYQQHMPERRKLIYCSRT
MSEIEKALVELKALMKYRAEQFGHEENFRGLGLTSRKNLCLHPSVKREKSGSIVDARCRSLTAGFVKEKKEKGEN
VDVCIYHDNLDLLEPYNLIPNGVWTFDGILRYGEEHKQCPYFTARRMMQYCNVVIFSYHYLLDPKIAERVSRDFS
KDCIVVFDEAHNIDNVCIESLSTDITEDSLRKASRGAQNLERKIAEMRETDQQQLQNEYQKLVQGLRDAEEARQE
DAFVSNPALPEDLLKEAVPGNIRRAEHFIAFLKRFIEYMKTRMRVRQVISETPLSFLGHLKEHTFIERKPLRFCA
ERLTSLVRTLELTNIEDYHPLQEVATFATLVATYEKGFLLILEPYESDTAEVPNPIFHFTCLDAAIAIRPVFERF
YSVIITSGTISPLEMYPKMLDFSTVIQESYSMTLARRSFLPMIVTRGSDQASVSTSFQVRNEPSVVRNYGTLLTE
FAKITPDGVVVFFPSYLYMESIISMWQGMGILDEIWKYKLILVETPDAQETSLALETYRTACCNGRGAILLCVAR
GKVSEGIDFDHQYGRTVLCIGVPFQYTESRILKARLEFLRETYRIRENDFLSFDAMRHAAQCLGRVLRGKDDYGI
MVLADRRFQKKRAQLPKWISQGLLEADVNMSTDMAVASARKFLRTMAQPFRAKDQEGISTWGPEDLRRHREKMDL
DRRLEPEDAALNPLARDISAVDGFEFEDGVLDEEMMDMDGF*
Coding >Ophcf2|04288
ATGAAGTTTGAGATAGAGGGCCTGCCGGTCCTCTTTCCATATCCCCGAATATATCCAGAACAATACGCCTACATG
TGCGATCTCAAAAAAACTCTCGACGCAGGCGGTCACTGCGTTCTTGAGATGCCTTCCGGAACCGGCAAGACCGTG
TCGCTACTCTCCTTGATTGTCGCATACCAACAACATATGCCGGAACGTCGAAAGCTCATATATTGCTCACGAACA
ATGTCTGAGATCGAAAAGGCACTGGTCGAGCTGAAAGCCTTAATGAAGTACCGGGCGGAACAATTTGGGCACGAA
GAGAATTTCCGAGGTCTGGGGCTCACCAGCCGTAAAAACCTCTGTCTTCACCCATCAGTCAAGCGGGAGAAGAGT
GGTTCGATTGTTGATGCTCGCTGCAGGAGTTTGACGGCCGGCTTCGTCAAGGAGAAGAAGGAAAAGGGCGAGAAC
GTGGATGTCTGCATCTATCACGACAACCTCGACCTCTTGGAACCATACAATCTAATACCTAACGGAGTTTGGACA
TTTGACGGCATCCTTCGATACGGAGAAGAACATAAACAATGCCCTTACTTCACCGCAAGAAGAATGATGCAGTAC
TGCAACGTCGTCATTTTCTCGTACCATTACCTCCTGGATCCCAAAATTGCCGAGCGAGTCTCGCGGGACTTCTCC
AAAGACTGCATTGTGGTATTCGACGAAGCTCACAACATTGACAACGTCTGCATAGAGTCTCTCAGCACGGACATC
ACAGAAGATTCCCTAAGGAAAGCATCACGAGGAGCGCAGAATCTGGAGAGGAAAATTGCCGAGATGCGGGAGACA
GACCAGCAGCAATTGCAAAATGAATATCAGAAACTCGTCCAGGGCCTCAGGGATGCTGAAGAAGCCCGACAGGAG
GACGCCTTTGTTTCCAATCCCGCTCTCCCTGAAGACCTCCTCAAAGAAGCTGTGCCTGGAAACATCAGAAGAGCT
GAGCATTTCATCGCCTTTCTCAAGCGCTTTATAGAGTATATGAAGACGCGGATGAGAGTCCGCCAGGTCATCTCT
GAAACGCCCCTTTCTTTCCTGGGCCATCTCAAGGAGCACACCTTTATCGAAAGGAAGCCCCTGAGGTTCTGCGCG
GAGCGCCTGACATCACTTGTGCGGACCTTGGAGTTGACCAACATAGAGGACTACCATCCACTGCAGGAGGTGGCA
ACGTTTGCGACGCTGGTAGCGACCTACGAGAAGGGATTCTTGCTGATTCTGGAACCGTACGAATCGGACACTGCC
GAGGTCCCTAATCCCATTTTCCATTTCACGTGCTTGGACGCGGCCATTGCTATCCGGCCGGTGTTTGAGCGATTT
TACTCAGTCATCATAACGTCGGGAACAATCTCGCCTCTCGAGATGTATCCCAAGATGCTGGACTTTTCTACCGTC
ATCCAAGAATCTTACAGCATGACTTTGGCGCGAAGGTCGTTTCTACCCATGATAGTCACGCGCGGAAGTGACCAG
GCTTCTGTCTCGACCAGCTTCCAGGTCAGAAACGAGCCAAGCGTGGTGCGCAACTATGGCACCCTTTTGACGGAA
TTCGCGAAAATCACACCCGACGGAGTCGTCGTCTTCTTCCCGTCCTATCTCTACATGGAATCCATCATCAGCATG
TGGCAAGGGATGGGCATCCTCGATGAGATCTGGAAATACAAGCTGATACTGGTCGAGACGCCTGACGCGCAAGAG
ACATCGCTGGCTCTCGAGACGTATCGTACCGCTTGCTGCAACGGAAGAGGCGCCATCCTCCTCTGCGTGGCCCGC
GGCAAGGTCTCAGAGGGTATCGATTTTGATCACCAGTACGGTCGTACGGTGCTGTGCATCGGAGTGCCCTTCCAG
TACACCGAGTCCCGCATCCTCAAGGCCAGGCTCGAGTTTCTCAGGGAGACTTACCGGATCAGAGAAAACGACTTC
CTGTCCTTTGATGCCATGCGTCACGCTGCCCAGTGTCTCGGACGAGTGTTGCGAGGCAAAGACGACTATGGAATC
ATGGTGCTAGCCGATCGTCGTTTTCAGAAGAAGAGAGCGCAGTTGCCCAAGTGGATCAGCCAGGGATTGCTCGAA
GCCGATGTCAATATGAGCACCGACATGGCAGTAGCCAGTGCCCGCAAGTTTCTCAGGACCATGGCCCAGCCGTTT
CGCGCCAAGGACCAGGAAGGCATAAGTACTTGGGGGCCTGAGGATCTGAGGAGACACAGGGAGAAGATGGACTTG
GATAGACGCCTTGAGCCCGAGGACGCTGCCCTAAACCCCTTGGCCCGGGATATCTCGGCCGTCGACGGTTTTGAA
TTCGAAGATGGGGTCCTTGACGAGGAGATGATGGACATGGACGGTTTTTGA
Transcript >Ophcf2|04288
ATGAAGTTTGAGATAGAGGGCCTGCCGGTCCTCTTTCCATATCCCCGAATATATCCAGAACAATACGCCTACATG
TGCGATCTCAAAAAAACTCTCGACGCAGGCGGTCACTGCGTTCTTGAGATGCCTTCCGGAACCGGCAAGACCGTG
TCGCTACTCTCCTTGATTGTCGCATACCAACAACATATGCCGGAACGTCGAAAGCTCATATATTGCTCACGAACA
ATGTCTGAGATCGAAAAGGCACTGGTCGAGCTGAAAGCCTTAATGAAGTACCGGGCGGAACAATTTGGGCACGAA
GAGAATTTCCGAGGTCTGGGGCTCACCAGCCGTAAAAACCTCTGTCTTCACCCATCAGTCAAGCGGGAGAAGAGT
GGTTCGATTGTTGATGCTCGCTGCAGGAGTTTGACGGCCGGCTTCGTCAAGGAGAAGAAGGAAAAGGGCGAGAAC
GTGGATGTCTGCATCTATCACGACAACCTCGACCTCTTGGAACCATACAATCTAATACCTAACGGAGTTTGGACA
TTTGACGGCATCCTTCGATACGGAGAAGAACATAAACAATGCCCTTACTTCACCGCAAGAAGAATGATGCAGTAC
TGCAACGTCGTCATTTTCTCGTACCATTACCTCCTGGATCCCAAAATTGCCGAGCGAGTCTCGCGGGACTTCTCC
AAAGACTGCATTGTGGTATTCGACGAAGCTCACAACATTGACAACGTCTGCATAGAGTCTCTCAGCACGGACATC
ACAGAAGATTCCCTAAGGAAAGCATCACGAGGAGCGCAGAATCTGGAGAGGAAAATTGCCGAGATGCGGGAGACA
GACCAGCAGCAATTGCAAAATGAATATCAGAAACTCGTCCAGGGCCTCAGGGATGCTGAAGAAGCCCGACAGGAG
GACGCCTTTGTTTCCAATCCCGCTCTCCCTGAAGACCTCCTCAAAGAAGCTGTGCCTGGAAACATCAGAAGAGCT
GAGCATTTCATCGCCTTTCTCAAGCGCTTTATAGAGTATATGAAGACGCGGATGAGAGTCCGCCAGGTCATCTCT
GAAACGCCCCTTTCTTTCCTGGGCCATCTCAAGGAGCACACCTTTATCGAAAGGAAGCCCCTGAGGTTCTGCGCG
GAGCGCCTGACATCACTTGTGCGGACCTTGGAGTTGACCAACATAGAGGACTACCATCCACTGCAGGAGGTGGCA
ACGTTTGCGACGCTGGTAGCGACCTACGAGAAGGGATTCTTGCTGATTCTGGAACCGTACGAATCGGACACTGCC
GAGGTCCCTAATCCCATTTTCCATTTCACGTGCTTGGACGCGGCCATTGCTATCCGGCCGGTGTTTGAGCGATTT
TACTCAGTCATCATAACGTCGGGAACAATCTCGCCTCTCGAGATGTATCCCAAGATGCTGGACTTTTCTACCGTC
ATCCAAGAATCTTACAGCATGACTTTGGCGCGAAGGTCGTTTCTACCCATGATAGTCACGCGCGGAAGTGACCAG
GCTTCTGTCTCGACCAGCTTCCAGGTCAGAAACGAGCCAAGCGTGGTGCGCAACTATGGCACCCTTTTGACGGAA
TTCGCGAAAATCACACCCGACGGAGTCGTCGTCTTCTTCCCGTCCTATCTCTACATGGAATCCATCATCAGCATG
TGGCAAGGGATGGGCATCCTCGATGAGATCTGGAAATACAAGCTGATACTGGTCGAGACGCCTGACGCGCAAGAG
ACATCGCTGGCTCTCGAGACGTATCGTACCGCTTGCTGCAACGGAAGAGGCGCCATCCTCCTCTGCGTGGCCCGC
GGCAAGGTCTCAGAGGGTATCGATTTTGATCACCAGTACGGTCGTACGGTGCTGTGCATCGGAGTGCCCTTCCAG
TACACCGAGTCCCGCATCCTCAAGGCCAGGCTCGAGTTTCTCAGGGAGACTTACCGGATCAGAGAAAACGACTTC
CTGTCCTTTGATGCCATGCGTCACGCTGCCCAGTGTCTCGGACGAGTGTTGCGAGGCAAAGACGACTATGGAATC
ATGGTGCTAGCCGATCGTCGTTTTCAGAAGAAGAGAGCGCAGTTGCCCAAGTGGATCAGCCAGGGATTGCTCGAA
GCCGATGTCAATATGAGCACCGACATGGCAGTAGCCAGTGCCCGCAAGTTTCTCAGGACCATGGCCCAGCCGTTT
CGCGCCAAGGACCAGGAAGGCATAAGTACTTGGGGGCCTGAGGATCTGAGGAGACACAGGGAGAAGATGGACTTG
GATAGACGCCTTGAGCCCGAGGACGCTGCCCTAAACCCCTTGGCCCGGGATATCTCGGCCGTCGACGGTTTTGAA
TTCGAAGATGGGGTCCTTGACGAGGAGATGATGGACATGGACGGTTTTTGA
Gene >Ophcf2|04288
ATGAAGTTTGAGATAGAGTACGAATCCGTGAAGTCGTTCGCGGCCTCTTGCGCTGACTCTGTTGCAGGGGCCTGC
CGGTCCTCTTTCCATATCCCCGAATATATCCAGGTATGCTCAAATCTACTCTGCCGGTTCTTTGATAACTAACCT
GGACGCGATGCTCTTGCAGAACAATACGCGTGAGTTCCCGCGCCTGGGACATTTCTCGCAGCTTACTGACTTGCA
TACGAAGCTACATGTGCGATCTCAAAAGTACAGGCTGAGTGCCCTTCGTCTACGATACGATATCCTCTGCTCCAG
TGCTGACGCGCGACAATGTGCAGAAACTCTCGACGCAGGCGGTCACTGCGTTCTTGAGATGCCTTCCGGAACCGG
CAAGACCGTGTCGCTACTCTCCTTGATTGTCGCATACCAACAACATATGCCGGAACGTCGAAAGCTCATATATTG
CTCACGTATGATCCCGAACCACAGAATCGCACCTATATGTCATAGTACCACTCTGACTATAACCCAGGAACAATG
TCTGAGATCGAAAAGGCACTGGTCGAGCTGAAAGCCTTAATGAAGTACCGGGCGGAACAATTTGGGCACGAAGAG
AATTTCCGAGGTCTGGGGCTCACCAGCCGTAAAAACCTCTGTCTTCACCCATCAGTCAAGCGGGAGAAGAGTGGT
TCGATTGTTGATGCTCGCTGCAGGAGTTTGACGGCCGGCTTCGTCAAGGAGAAGAAGGAAAAGGGCGAGAACGTG
GATGTCTGCATCTATCACGACGTAAGATGGAAGCCTTCCCCTTTCCTCGGTTCCCGGAACAATCCTGACTTGCAT
ACAGAACCTCGACCTCTTGGAACCATACAATCTAATACCTAACGGAGTTTGGACATTTGACGGCATCCTTCGATA
CGGAGAAGAACATAAACAATGCCCTTACTTCACCGCAAGAAGAATGGTAGGCAATCCTGAGCTTCTGAAATGAAA
AGTTCTGATGGCAAGTCTTTAGATGCAGTACTGCAACGTCGTCATTTTCTCGTACCATTACCTCCTGGATCCCAA
AATTGCCGAGCGAGTCTCGCGGGACTTCTCCAAAGACTGCATTGTGGTATTCGACGAAGCTCACAACATTGACAA
CGTCTGCATAGAGTCTCTCAGCACGGACATCACAGAAGATTCCCTAAGGAAAGCATCACGAGGAGCGCAGAATCT
GGAGAGGAAAATTGCCGAGATGCGGGAGACAGACCAGCAGCAATTGCAAAATGAATATCAGAAACTCGTCCAGGG
CCTCAGGGATGCTGAAGAAGCCCGACAGGAGGACGCCTTTGTTTCCAATCCCGGTAAGAGCCCTACACTATTGTC
GCGACTCTGGTCAACTGACACCTTTCATAGCTCTCCCTGAAGACCTCCTCAAAGAAGCTGTGCCTGGAAACATCA
GAAGAGCTGAGCATTTCATCGCCTTTCTCAAGCGCTTTATAGAGTATATGAAGGTGATTTCACTCGCTTACCCGC
AGCAGTTGCATGGCTAACTGGCAGCAGACGCGGATGAGAGTCCGCCAGGTCATCTCTGAAACGCCCCTTTCTTTC
CTGGGCCATCTCAAGGAGCACACCTTTATCGAAAGGAAGCCCCTGAGGTTCTGCGCGGAGCGCCTGACATCACTT
GTGCGGACCTTGGAGTTGACCAACATAGAGGACTACCATCCACTGCAGGAGGTGGCAACGTTTGCGACGCTGGTA
GCGACCTACGAGAAGGGATTCTTGCTGATTCTGGAACCGTACGAATCGGACACTGCCGAGGTCCCTAATCCCATT
TTCCATTTCACGTGCTTGGACGCGGCCATTGCTATCCGGCCGGTGTTTGAGCGATTTTACTCAGTCATCATAACG
TCGGGAACAATCTCGCCTCTCGAGATGTATCCCAAGATGCTGGACTTTTCTACCGTCATCCAAGAATCTTACAGC
ATGACTTTGGCGCGAAGGTCGTTTCTACCCATGATAGTCACGCGCGGAAGTGACCAGGCTTCTGTCTCGACCAGC
TTCCAGGTCAGAAACGAGCCAAGCGTGGTGCGCAACTATGGCACCCTTTTGACGGAATTCGCGAAAATCACACCC
GACGGAGTCGTCGTCTTCTTCCCGTCCTATCTCTACATGGAATCCATCATCAGCATGTGGCAAGGGATGGGCATC
CTCGATGAGATCTGGAAATACAAGCTGATACTGGTCGAGACGCCTGACGCGCAAGAGACATCGCTGGCTCTCGAG
ACGTATCGTACCGCTTGCTGCAACGGAAGAGGCGCCATCCTCCTCTGCGTGGCCCGCGGCAAGGTCTCAGAGGGT
ATCGATTTTGATCACCAGTACGGTCGTACGGTGCTGTGCATCGGAGTGCCCTTCCAGTACACCGAGTCCCGCATC
CTCAAGGCCAGGCTCGAGTTTCTCAGGGAGACTTACCGGATCAGAGAAAACGACTTCCTGTCCTTTGATGCCATG
CGTCACGCTGCCCAGTGTCTCGGACGAGTGTTGCGAGGCAAAGACGACTATGGAATCATGGTGCTAGCCGATCGT
CGTTTTCAGAAGAAGAGAGCGCAGTTGCCCAAGTGGATCAGCCAGGGATTGCTCGAAGCCGATGTCAATATGAGC
ACCGACATGGCAGTAGCCAGTGCCCGCAAGTTTCTCAGGACCATGGCCCAGCCGTTTCGCGCCAAGGACCAGGAA
GGCATAAGTACTTGGGGGCCTGAGGATCTGAGGAGACACAGGGAGAAGATGGACTTGGATAGACGCCTTGAGCCC
GAGGACGCTGCCCTAAACCCCTTGGCCCGGGATATCTCGGCCGTCGACGGTTTTGAATTCGAAGATGGGGTCCTT
GACGAGGAGATGATGGACATGGACGGTTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail