Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04286
Gene name
Locationscaffold_04:2820335..2823438
Strand+
Gene length (bp)3103
Transcript length (bp)3054
Coding sequence length (bp)3054
Protein length (aa) 1018

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02779 Transket_pyr Transketolase, pyrimidine binding domain 1.6E-62 638 850
PF00676 E1_dh Dehydrogenase E1 component 1.4E-56 249 566
PF16870 OxoGdeHyase_C 2-oxoglutarate dehydrogenase C-terminal 4.6E-54 853 1007
PF16078 2-oxogl_dehyd_N 2-oxoglutarate dehydrogenase N-terminus 7.8E-19 35 74

GO

GO Term Description Terminal node
GO:0016624 oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor Yes
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1634 0.1156 0.0832 0.068 0.8986 0.0904 0.0243 0.0638 0.1353 0.0421

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2120
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4142
Ophiocordyceps australis map64 (Brazil) OphauB2|2505
Ophiocordyceps camponoti-floridani Ophcf2|04286 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2105
Ophiocordyceps kimflemingae Ophio5|8213
Ophiocordyceps subramaniannii Hirsu2|2529

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04286
MKSVTITSRRLGALQTSAAACYATSATHSPPDPSDNFLSGSTANYIDEMYMQWKHDPKSVHVSWQVYFKNMETGD
MPISQAFQPPPNLVPNMTGGVPRLGGGGLALEDGSDVTNHLKVQLLVRAYQARGHHKANIDPLDIRNTTTGFGNI
KPKELTLEHYGFTEKDMDKEYTLGPGILPRFKKDNRVKMTLREIIAACEKIYAGSYGVEFIHIPDREKCDWLRER
LEVPQPFKYSIDEKRRILDRLIWSSSFEAFLATKYPNDKRFGLEGCETLVPGMKALIDRSVDYGVKDIVIGMPHR
GRLNVLSNVVRKPNESIFSEFAGTGGAEDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKT
RAIQHYNNDEKTHRTAMSVLLHGDAALAAQGIVYECLGFHSLPAFSTGGTVHLVVNNQIGFTTDPRFARSTAYCT
DIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLICYRKHGHNETDQPSFTQPLMYKRIHSKKPQI
DVYVNKLLRDGTFTKEDIEEHKQWVWGMLEESFDKSKDYQSTSKEWTTSAWNGFKSPKELAAEILPHHATRVDRK
TLDHVGEVIGSAPEGFHIHRNLKRILSNRTKSVIEGQNIDFPTAEALAFGSLATEGYHVRVSGQDVERGTFSQRH
AVFHDQETEETYIPLQHVSKDQGKFVIANSSLSEFGALGFEYGYSLSSPNALVMWEAQFGDFANNAQCIIDQFIA
SGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLCNEDPRIFPSEEKLARQHQDCNMQIAYMTTPANLFHA
LRRQMQRQFRKPLIIFFSKALLRHPLARSNMEDFAGEDAGFKWIIPDPEHQNGSLKSPDEIDRVILCTGQVWTSL
QKYRADHEIDNVALTRIEQLNPFPWQQLKDNLDMYPNAKTIVWAQEEPLNAGAWSFTQPRIETLLNQTKYHDRKH
VMYAGRNPSASVATGMKQVHSKEEQELLEMAFTVKQDKLKGE*
Coding >Ophcf2|04286
ATGAAATCCGTGACGATAACGTCTCGTAGACTGGGCGCCTTGCAGACGTCAGCCGCTGCTTGCTACGCCACCAGC
GCGACACATTCGCCGCCAGATCCGAGTGACAACTTTCTATCTGGAAGTACCGCTAATTACATCGACGAGATGTAC
ATGCAATGGAAGCATGATCCAAAAAGCGTCCACGTCTCCTGGCAGGTCTACTTCAAGAACATGGAAACCGGCGAC
ATGCCCATCTCTCAGGCGTTCCAGCCGCCCCCAAACTTGGTGCCTAACATGACAGGCGGCGTGCCTCGCTTGGGT
GGCGGTGGCCTCGCCCTCGAAGATGGCTCCGATGTTACCAACCATCTCAAAGTTCAGTTGCTGGTTCGCGCCTAC
CAGGCCCGCGGCCATCACAAAGCCAACATCGATCCCCTAGACATACGCAACACAACGACTGGTTTTGGCAACATT
AAACCCAAAGAGTTGACTCTCGAGCACTATGGTTTCACAGAAAAGGATATGGATAAGGAGTACACTCTGGGTCCC
GGAATTCTTCCTCGATTCAAAAAGGACAACCGCGTCAAGATGACACTTCGCGAGATTATTGCCGCCTGCGAGAAG
ATATATGCCGGCTCGTACGGCGTAGAATTCATTCACATTCCCGATCGCGAGAAGTGCGACTGGCTGCGCGAGCGG
CTTGAGGTTCCTCAACCCTTTAAATACTCCATCGACGAGAAGCGTCGCATCCTCGATCGCCTGATCTGGAGCTCC
AGTTTCGAGGCGTTTCTGGCAACTAAATACCCAAATGACAAGCGTTTTGGACTTGAAGGCTGCGAGACTCTCGTC
CCTGGTATGAAGGCGTTGATCGATCGAAGTGTTGATTACGGCGTCAAAGACATAGTGATTGGCATGCCTCACCGC
GGTCGTCTCAACGTCCTCAGCAATGTCGTCCGGAAACCAAACGAATCCATTTTCTCCGAATTTGCCGGCACCGGC
GGTGCCGAGGACGAGGGCTCTGGCGATGTCAAATACCATCTGGGCATGAATTTTGAGCGTCCTACGCCGTCGGGG
AAGCGCGTCCAACTCTCACTGGTCGCCAACCCGTCGCACCTAGAAGCTGAGGATCCCGTCGTTCTCGGAAAGACG
CGCGCTATACAACACTACAATAACGATGAGAAGACGCACAGGACAGCAATGAGTGTCCTCTTACACGGTGACGCC
GCATTAGCCGCTCAGGGCATCGTTTACGAGTGTCTGGGCTTCCACTCGCTTCCGGCCTTTTCAACCGGTGGCACC
GTTCATCTTGTCGTGAACAATCAAATTGGGTTTACGACTGATCCTCGCTTCGCCCGCTCCACGGCATACTGCACC
GACATTGCCAAAGCCATTGACGCGCCAGTCTTCCACGTGAACGCCGACGACGTTGAGGCCGTCAACTTCGTCTGT
CAGCTTGCCGCCGATTGGCGGGCCGAGTTTCAGCATGACGTCGTCATCGATCTCATATGCTACCGCAAACACGGC
CACAATGAGACAGATCAACCGTCGTTTACGCAGCCGCTCATGTATAAACGCATTCATTCCAAGAAGCCTCAGATT
GATGTGTACGTCAATAAGCTACTTCGGGATGGCACGTTTACCAAGGAGGACATCGAGGAGCATAAGCAATGGGTT
TGGGGCATGCTGGAGGAGAGTTTCGACAAGTCCAAGGACTATCAATCGACTTCAAAGGAGTGGACGACATCAGCC
TGGAACGGCTTCAAATCCCCCAAAGAGCTTGCCGCCGAGATCCTGCCCCATCACGCTACCCGAGTTGACAGGAAG
ACGTTGGATCACGTTGGCGAGGTCATCGGATCGGCTCCCGAGGGCTTCCATATCCACCGTAATCTGAAGCGCATC
CTGAGCAACAGAACCAAGTCGGTCATCGAGGGACAGAACATCGACTTCCCCACGGCCGAGGCTCTCGCGTTCGGA
TCTCTGGCTACCGAGGGCTATCACGTTCGCGTGTCCGGTCAGGACGTCGAGCGCGGCACCTTTTCGCAGCGTCAT
GCCGTCTTCCACGATCAGGAGACTGAGGAAACTTATATACCCCTTCAGCACGTCAGCAAGGACCAAGGCAAGTTC
GTCATCGCCAATTCGTCTCTTAGCGAGTTTGGTGCTCTCGGATTCGAGTACGGCTACTCGCTGTCGTCTCCCAAC
GCGCTCGTCATGTGGGAGGCCCAGTTTGGCGACTTTGCCAACAACGCGCAGTGTATCATCGATCAGTTCATCGCG
TCAGGCGAAGTCAAGTGGATGCAGCGGACCGGTCTCGTCATGTCTCTGCCCCACGGATACGACGGCCAAGGCCCG
GAGCACTCGTCAGGCCGTCTGGAGCGCTATCTGCAGCTGTGTAACGAAGACCCGCGCATCTTCCCATCCGAGGAG
AAGCTTGCCCGTCAGCACCAGGACTGCAATATGCAGATTGCCTACATGACGACTCCCGCCAACCTGTTCCACGCG
TTGCGCCGCCAGATGCAGCGTCAGTTCCGGAAGCCTCTCATCATCTTCTTCTCCAAGGCTCTCCTACGTCATCCT
CTCGCGCGATCCAATATGGAGGACTTTGCCGGAGAAGACGCCGGATTCAAGTGGATCATCCCCGACCCCGAACAC
CAGAATGGCAGCCTGAAGTCTCCGGATGAGATCGATCGTGTGATTCTCTGCACCGGTCAGGTCTGGACAAGCCTG
CAAAAATACCGTGCTGACCATGAAATCGACAACGTCGCGCTCACTCGGATCGAGCAGTTAAACCCTTTCCCTTGG
CAACAGCTGAAGGACAACTTGGACATGTATCCTAACGCGAAAACCATCGTCTGGGCTCAGGAGGAACCTCTCAAC
GCCGGCGCCTGGAGCTTCACGCAGCCCCGTATCGAGACGCTGCTCAATCAAACCAAGTACCACGACCGGAAGCAT
GTCATGTATGCCGGCCGCAACCCGAGTGCCTCAGTAGCGACAGGCATGAAACAGGTGCATTCTAAGGAGGAGCAA
GAACTCTTGGAGATGGCTTTCACTGTCAAGCAGGACAAGCTCAAGGGTGAATAA
Transcript >Ophcf2|04286
ATGAAATCCGTGACGATAACGTCTCGTAGACTGGGCGCCTTGCAGACGTCAGCCGCTGCTTGCTACGCCACCAGC
GCGACACATTCGCCGCCAGATCCGAGTGACAACTTTCTATCTGGAAGTACCGCTAATTACATCGACGAGATGTAC
ATGCAATGGAAGCATGATCCAAAAAGCGTCCACGTCTCCTGGCAGGTCTACTTCAAGAACATGGAAACCGGCGAC
ATGCCCATCTCTCAGGCGTTCCAGCCGCCCCCAAACTTGGTGCCTAACATGACAGGCGGCGTGCCTCGCTTGGGT
GGCGGTGGCCTCGCCCTCGAAGATGGCTCCGATGTTACCAACCATCTCAAAGTTCAGTTGCTGGTTCGCGCCTAC
CAGGCCCGCGGCCATCACAAAGCCAACATCGATCCCCTAGACATACGCAACACAACGACTGGTTTTGGCAACATT
AAACCCAAAGAGTTGACTCTCGAGCACTATGGTTTCACAGAAAAGGATATGGATAAGGAGTACACTCTGGGTCCC
GGAATTCTTCCTCGATTCAAAAAGGACAACCGCGTCAAGATGACACTTCGCGAGATTATTGCCGCCTGCGAGAAG
ATATATGCCGGCTCGTACGGCGTAGAATTCATTCACATTCCCGATCGCGAGAAGTGCGACTGGCTGCGCGAGCGG
CTTGAGGTTCCTCAACCCTTTAAATACTCCATCGACGAGAAGCGTCGCATCCTCGATCGCCTGATCTGGAGCTCC
AGTTTCGAGGCGTTTCTGGCAACTAAATACCCAAATGACAAGCGTTTTGGACTTGAAGGCTGCGAGACTCTCGTC
CCTGGTATGAAGGCGTTGATCGATCGAAGTGTTGATTACGGCGTCAAAGACATAGTGATTGGCATGCCTCACCGC
GGTCGTCTCAACGTCCTCAGCAATGTCGTCCGGAAACCAAACGAATCCATTTTCTCCGAATTTGCCGGCACCGGC
GGTGCCGAGGACGAGGGCTCTGGCGATGTCAAATACCATCTGGGCATGAATTTTGAGCGTCCTACGCCGTCGGGG
AAGCGCGTCCAACTCTCACTGGTCGCCAACCCGTCGCACCTAGAAGCTGAGGATCCCGTCGTTCTCGGAAAGACG
CGCGCTATACAACACTACAATAACGATGAGAAGACGCACAGGACAGCAATGAGTGTCCTCTTACACGGTGACGCC
GCATTAGCCGCTCAGGGCATCGTTTACGAGTGTCTGGGCTTCCACTCGCTTCCGGCCTTTTCAACCGGTGGCACC
GTTCATCTTGTCGTGAACAATCAAATTGGGTTTACGACTGATCCTCGCTTCGCCCGCTCCACGGCATACTGCACC
GACATTGCCAAAGCCATTGACGCGCCAGTCTTCCACGTGAACGCCGACGACGTTGAGGCCGTCAACTTCGTCTGT
CAGCTTGCCGCCGATTGGCGGGCCGAGTTTCAGCATGACGTCGTCATCGATCTCATATGCTACCGCAAACACGGC
CACAATGAGACAGATCAACCGTCGTTTACGCAGCCGCTCATGTATAAACGCATTCATTCCAAGAAGCCTCAGATT
GATGTGTACGTCAATAAGCTACTTCGGGATGGCACGTTTACCAAGGAGGACATCGAGGAGCATAAGCAATGGGTT
TGGGGCATGCTGGAGGAGAGTTTCGACAAGTCCAAGGACTATCAATCGACTTCAAAGGAGTGGACGACATCAGCC
TGGAACGGCTTCAAATCCCCCAAAGAGCTTGCCGCCGAGATCCTGCCCCATCACGCTACCCGAGTTGACAGGAAG
ACGTTGGATCACGTTGGCGAGGTCATCGGATCGGCTCCCGAGGGCTTCCATATCCACCGTAATCTGAAGCGCATC
CTGAGCAACAGAACCAAGTCGGTCATCGAGGGACAGAACATCGACTTCCCCACGGCCGAGGCTCTCGCGTTCGGA
TCTCTGGCTACCGAGGGCTATCACGTTCGCGTGTCCGGTCAGGACGTCGAGCGCGGCACCTTTTCGCAGCGTCAT
GCCGTCTTCCACGATCAGGAGACTGAGGAAACTTATATACCCCTTCAGCACGTCAGCAAGGACCAAGGCAAGTTC
GTCATCGCCAATTCGTCTCTTAGCGAGTTTGGTGCTCTCGGATTCGAGTACGGCTACTCGCTGTCGTCTCCCAAC
GCGCTCGTCATGTGGGAGGCCCAGTTTGGCGACTTTGCCAACAACGCGCAGTGTATCATCGATCAGTTCATCGCG
TCAGGCGAAGTCAAGTGGATGCAGCGGACCGGTCTCGTCATGTCTCTGCCCCACGGATACGACGGCCAAGGCCCG
GAGCACTCGTCAGGCCGTCTGGAGCGCTATCTGCAGCTGTGTAACGAAGACCCGCGCATCTTCCCATCCGAGGAG
AAGCTTGCCCGTCAGCACCAGGACTGCAATATGCAGATTGCCTACATGACGACTCCCGCCAACCTGTTCCACGCG
TTGCGCCGCCAGATGCAGCGTCAGTTCCGGAAGCCTCTCATCATCTTCTTCTCCAAGGCTCTCCTACGTCATCCT
CTCGCGCGATCCAATATGGAGGACTTTGCCGGAGAAGACGCCGGATTCAAGTGGATCATCCCCGACCCCGAACAC
CAGAATGGCAGCCTGAAGTCTCCGGATGAGATCGATCGTGTGATTCTCTGCACCGGTCAGGTCTGGACAAGCCTG
CAAAAATACCGTGCTGACCATGAAATCGACAACGTCGCGCTCACTCGGATCGAGCAGTTAAACCCTTTCCCTTGG
CAACAGCTGAAGGACAACTTGGACATGTATCCTAACGCGAAAACCATCGTCTGGGCTCAGGAGGAACCTCTCAAC
GCCGGCGCCTGGAGCTTCACGCAGCCCCGTATCGAGACGCTGCTCAATCAAACCAAGTACCACGACCGGAAGCAT
GTCATGTATGCCGGCCGCAACCCGAGTGCCTCAGTAGCGACAGGCATGAAACAGGTGCATTCTAAGGAGGAGCAA
GAACTCTTGGAGATGGCTTTCACTGTCAAGCAGGACAAGCTCAAGGGTGAATAA
Gene >Ophcf2|04286
ATGAAATCCGTGACGATAACGTCTCGTAGACTGGGCGCCTTGCAGACGTCAGCCGCTGCTTGCTACGCCACCAGC
GCGACACATTCGCCGCCAGATCCGAGTGACAACTTTCTATCTGGAAGTACCGCTAATTACATCGACGAGATGTAC
ATGCAATGGAAGCATGATCCAAAAAGCGTCCACGTCTCCTGGCAGGTCTACTTCAAGAACATGGAAACCGGCGAC
ATGCCCATCTCTCAGGCGTTCCAGCCGCCCCCAAACTTGGTGCCTAACATGACAGGCGGCGTGCCTCGCTTGGGT
GGCGGTGGCCTCGCCCTCGAAGATGGCTCCGATGTTACCAACCATCTCAAAGTTCAGTTGCTGGTTCGCGCCTAC
CAGGCCCGCGGCCATCACAAAGCCAACATCGATCCCCTAGACATACGCAACACAACGACTGGTTTTGGCAACATT
AAACCCAAAGAGTTGACTCTCGAGCACTATGGTTTCACAGAAAAGGATATGGATAAGGAGTACACTCTGGGTCCC
GGAATTCTTCCTCGATTCAAAAAGGACAACCGCGTCAAGATGACACTTCGCGAGATTATTGCCGCCTGCGAGAAG
ATATATGCCGGCTCGTACGGCGTAGAATTCATTCACATTCCCGATCGCGAGAAGTGCGACTGGCTGCGCGAGCGG
CTTGAGGTTCCTCAACCCTTTAAATACTCCATCGACGAGAAGCGTCGCATCCTCGATCGCCTGATCTGGAGCTCC
AGTTTCGAGGCGTTTCTGGCAACTAAATACCCAAATGACAAGCGTTTTGGACTTGAAGGCTGCGAGACTCTCGTC
CCTGGTATGAAGGCGTTGATCGATCGAAGTGTTGATTACGGCGTCAAAGACATAGTGATTGGCATGCCTCACCGC
GGTCGTCTCAACGTCCTCAGCAATGTCGTCCGGAAACCAAACGAATCCATTTTCTCCGAATTTGCCGGCACCGGC
GGTGCCGAGGACGAGGGCTCTGGCGATGTCAAATACCATCTGGGCATGAATTTTGAGCGTCCTACGCCGTCGGGG
AAGCGCGTCCAACTCTCACTGGTCGCCAACCCGTCGCACCTAGAAGCTGAGGATCCCGTCGTTCTCGGAAAGACG
CGCGCTATACAACACTACAATAACGATGAGAAGACGCACAGGACAGCAATGAGTGTCCTCTTACACGGTGACGCC
GCATTAGCCGCTCAGGGCATCGTTTACGAGTGTCTGGGCTTCCACTCGCTTCCGGCCTTTTCAACCGGTGGCACC
GTTCATCTTGTCGTGAACAATCAAATTGGGTTTACGACTGATCCTCGCTTCGCCCGCTCCACGGCATACTGCACC
GACATTGCCAAAGCCATTGACGCGCCAGTCTTCCACGTGAACGCCGACGACGTTGAGGCCGTCAACTTCGTCTGT
CAGCTTGCCGCCGATTGGCGGGCCGAGTTTCAGCATGACGTCGTCATCGATCTCATATGCTACCGCAAACACGGC
CACAATGAGACAGATCAACCGTCGTTTACGCAGCCGCTCATGTATAAACGCATTCATTCCAAGAAGCCTCAGATT
GATGTGTACGTCAATAAGCTACTTCGGGATGGCACGTTTACCAAGGAGGACATCGAGGAGCATAAGCAATGGGTT
TGGGGCATGCTGGAGGAGAGTTTCGACAAGTCCAAGGACTATCAATCGACTTCAAAGGAGTGGACGACATCAGCC
TGGAACGGCTTCAAATCCCCCAAAGAGCTTGCCGCCGAGATCCTGCCCCATCACGCTACCCGAGTTGACAGGAAG
ACGTTGGATCACGTTGGCGAGGTCATCGGATCGGCTCCCGAGGGCTTCCATATCCACCGTAATCTGAAGCGCATC
CTGAGCAACAGAACCAAGTCGGTCATCGAGGGACAGAACATCGACTTCCCCACGGCCGAGGCTCTCGCGTTCGGA
TCTCTGGCTACCGAGGGCTATCACGTTCGCGTGTCCGGTCAGGACGTCGAGCGCGGCACCTTTTCGCAGCGTCAT
GCCGTCTTCCACGATCAGGAGACTGAGGAAACTTATATACCCCTTCAGCACGTCAGCAAGGACCAAGGCAAGTTC
GTCATCGCCAATTCGTCTCTTAGCGAGTTTGGTGCTCTCGGATTCGAGTACGGCTACTCGCTGTCGTCTCCCAAC
GCGCTCGTCATGTGGGAGGCCCAGTTTGGCGACTTTGCCAACAACGCGCAGTGTATCATCGATCAGTTCATCGCG
TCAGGCGAAGTCAAGTGGATGCAGCGGACCGGTCTCGTCATGTCTCTGCCCCACGGATACGACGGCCAAGGCCCG
GAGCACTCGTCAGGCCGTCTGGAGCGCTATCTGCAGCTGTGTAACGAAGACCCGCGCATCTTCCCATCCGAGGAG
AAGCTTGCCCGTCAGCACCAGGACTGCAATATGCAGATTGCCTACATGACGACTCCCGCCAACCTGTTCCACGCG
TTGCGCCGCCAGATGCAGCGTCAGTTCCGGAAGCGTACGTTGTGCCGTTGATGACTGTCTGGTATCGACTGACAT
GATGGCAGCTCTCATCATCTTCTTCTCCAAGGCTCTCCTACGTCATCCTCTCGCGCGATCCAATATGGAGGACTT
TGCCGGAGAAGACGCCGGATTCAAGTGGATCATCCCCGACCCCGAACACCAGAATGGCAGCCTGAAGTCTCCGGA
TGAGATCGATCGTGTGATTCTCTGCACCGGTCAGGTCTGGACAAGCCTGCAAAAATACCGTGCTGACCATGAAAT
CGACAACGTCGCGCTCACTCGGATCGAGCAGTTAAACCCTTTCCCTTGGCAACAGCTGAAGGACAACTTGGACAT
GTATCCTAACGCGAAAACCATCGTCTGGGCTCAGGAGGAACCTCTCAACGCCGGCGCCTGGAGCTTCACGCAGCC
CCGTATCGAGACGCTGCTCAATCAAACCAAGTACCACGACCGGAAGCATGTCATGTATGCCGGCCGCAACCCGAG
TGCCTCAGTAGCGACAGGCATGAAACAGGTGCATTCTAAGGAGGAGCAAGAACTCTTGGAGATGGCTTTCACTGT
CAAGCAGGACAAGCTCAAGGGTGAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail