Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04280
Gene name
Locationscaffold_04:2782878..2784294
Strand+
Gene length (bp)1416
Transcript length (bp)1155
Coding sequence length (bp)1155
Protein length (aa) 385

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00557 Peptidase_M24 Metallopeptidase family M24 3.0E-48 123 353
PF15801 zf-C6H2 zf-MYND-like zinc finger, mRNA-binding 1.5E-20 10 55

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5962 0.5007 0.0142 0.0481 0.3823 0.0271 0.0804 0.0506 0.0844 0.0561

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3717
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6094
Ophiocordyceps australis map64 (Brazil) OphauB2|3216
Ophiocordyceps camponoti-floridani Ophcf2|04280 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2099
Ophiocordyceps kimflemingae Ophio5|1046
Ophiocordyceps subramaniannii Hirsu2|7253

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04280
MSDSTKKKTCLGIDCQNDVGSLQCPTCLKLDIKDSYFCSQDCFKKSWNSHKFLHKTQKADNYNPFPSFPFSGPLR
PVYPLSETRVVPKSIPHPVWWQDGNPKYSRSPLSRNKIEILDIKGQDAMRKSCRIAREVLDIAAAAAQPGVTTDF
VDEVVHRACIERNSYPSPLNYNHFPKSCCTSVNEVICHGIPDKRPLVDGDILNIDISLYHEGYHADLNETYYIGE
EAAKDPENIRVVEAARQCLEAAIQAVKPGVPIREFGNIIEKHAKTQNCSVIRTYCGHGVNTLFHCAPNVPHYAKN
KAVGECKPGMTFTIEPMIALGKYRDMTWPDNWTSTTIDGKRTAQFEHTLLVTEDGVEILTARNKDSPGGPVMMPG
EIQAVQTFS*
Coding >Ophcf2|04280
ATGTCTGACTCGACAAAGAAGAAAACATGCTTGGGAATCGACTGTCAGAACGACGTCGGATCGCTCCAATGCCCG
ACGTGTTTGAAGTTGGACATCAAGGATAGCTACTTCTGCTCACAGGATTGCTTCAAAAAGAGTTGGAATAGTCAC
AAATTCCTGCACAAGACACAAAAAGCGGACAACTATAACCCTTTTCCAAGTTTTCCCTTTTCTGGCCCTTTGCGC
CCGGTCTATCCACTTTCTGAGACCCGGGTTGTACCGAAATCGATACCTCATCCCGTGTGGTGGCAGGACGGAAAT
CCTAAGTACAGCCGCTCACCATTGAGTAGAAATAAGATCGAGATCCTCGATATCAAAGGGCAGGATGCGATGCGC
AAAAGCTGTCGCATCGCCAGGGAAGTTCTTGACATCGCGGCAGCGGCGGCACAGCCCGGTGTTACGACCGACTTT
GTTGATGAAGTCGTTCATCGTGCCTGCATAGAGCGCAATTCATATCCATCACCACTGAATTACAACCATTTTCCC
AAGTCCTGCTGCACCTCAGTCAATGAAGTCATATGCCACGGGATTCCCGACAAACGGCCATTGGTGGATGGTGAC
ATTCTCAACATCGACATTTCTCTTTACCACGAGGGATATCACGCCGACCTGAACGAAACTTACTACATTGGCGAA
GAGGCAGCCAAAGATCCTGAAAATATCCGGGTTGTCGAAGCAGCACGACAGTGTCTAGAGGCGGCAATTCAAGCC
GTGAAGCCAGGAGTTCCGATACGCGAGTTCGGCAACATCATTGAGAAACACGCCAAAACGCAAAACTGCAGCGTC
ATCCGAACATATTGCGGGCACGGAGTCAATACTCTCTTCCACTGCGCTCCTAACGTACCGCATTACGCCAAAAAT
AAGGCGGTGGGCGAATGCAAGCCGGGAATGACTTTCACCATTGAGCCGATGATAGCGTTGGGTAAGTACCGCGAC
ATGACCTGGCCAGACAACTGGACCAGCACTACAATTGACGGAAAGCGGACAGCGCAGTTTGAGCATACTCTCCTC
GTCACCGAAGATGGAGTGGAGATTCTTACTGCGAGAAACAAGGATTCGCCCGGGGGCCCCGTCATGATGCCCGGC
GAGATTCAAGCAGTACAAACGTTCAGTTGA
Transcript >Ophcf2|04280
ATGTCTGACTCGACAAAGAAGAAAACATGCTTGGGAATCGACTGTCAGAACGACGTCGGATCGCTCCAATGCCCG
ACGTGTTTGAAGTTGGACATCAAGGATAGCTACTTCTGCTCACAGGATTGCTTCAAAAAGAGTTGGAATAGTCAC
AAATTCCTGCACAAGACACAAAAAGCGGACAACTATAACCCTTTTCCAAGTTTTCCCTTTTCTGGCCCTTTGCGC
CCGGTCTATCCACTTTCTGAGACCCGGGTTGTACCGAAATCGATACCTCATCCCGTGTGGTGGCAGGACGGAAAT
CCTAAGTACAGCCGCTCACCATTGAGTAGAAATAAGATCGAGATCCTCGATATCAAAGGGCAGGATGCGATGCGC
AAAAGCTGTCGCATCGCCAGGGAAGTTCTTGACATCGCGGCAGCGGCGGCACAGCCCGGTGTTACGACCGACTTT
GTTGATGAAGTCGTTCATCGTGCCTGCATAGAGCGCAATTCATATCCATCACCACTGAATTACAACCATTTTCCC
AAGTCCTGCTGCACCTCAGTCAATGAAGTCATATGCCACGGGATTCCCGACAAACGGCCATTGGTGGATGGTGAC
ATTCTCAACATCGACATTTCTCTTTACCACGAGGGATATCACGCCGACCTGAACGAAACTTACTACATTGGCGAA
GAGGCAGCCAAAGATCCTGAAAATATCCGGGTTGTCGAAGCAGCACGACAGTGTCTAGAGGCGGCAATTCAAGCC
GTGAAGCCAGGAGTTCCGATACGCGAGTTCGGCAACATCATTGAGAAACACGCCAAAACGCAAAACTGCAGCGTC
ATCCGAACATATTGCGGGCACGGAGTCAATACTCTCTTCCACTGCGCTCCTAACGTACCGCATTACGCCAAAAAT
AAGGCGGTGGGCGAATGCAAGCCGGGAATGACTTTCACCATTGAGCCGATGATAGCGTTGGGTAAGTACCGCGAC
ATGACCTGGCCAGACAACTGGACCAGCACTACAATTGACGGAAAGCGGACAGCGCAGTTTGAGCATACTCTCCTC
GTCACCGAAGATGGAGTGGAGATTCTTACTGCGAGAAACAAGGATTCGCCCGGGGGCCCCGTCATGATGCCCGGC
GAGATTCAAGCAGTACAAACGTTCAGTTGA
Gene >Ophcf2|04280
ATGTCTGACTCGACAAAGAAGAAAACATGCTTGGGAATCGACTGTCAGAACGACGTCGGATCGCTCCAATGCCCG
ACGTGTTTGAAGTTGGACATCAAGGATAGCTACTTCTGCTCACAGGATTGCTTCAAAAAGAGTTGGGTCCGTGGT
TCGAAACTGTCTTGTGATCCTGTCTGTGGCCTGACTGTCGCTTCAGAATAGTCACAAATTCCTGCACAAGACACA
AAGTAAGAGTCACCATCAGATCGCCATCGAGATAGCATAGAATCTTACGAGATGCAGAAGCGGACAACTATAACC
CTTTTCCAAGTTTTCCCTTTTCTGGCCCTTTGCGCCCGGTCTATCCACTTTCTGAGACCCGGGTTGTACCGAAAT
CGATACCTCATCCCGTGTGGTGGCAGGACGGAAATCCTAAGTACAGCCGCTCACCATTGAGTAGAAATAAGATCG
AGATCCTCGATATCAAAGGGCAGGATGCGATGCGCAAAAGCTGTCGCATCGCCAGGGAAGTTCTTGACATCGCGG
CAGCGGCGGCACAGCCCGGTGTTACGACCGACTTTGTTGATGAAGTCGTTCATCGTGCCTGCATAGAGCGCAATG
TAAATTCCATGAGATCCGTCTGGCGCATGCTGGAAGTGTCGGAGACTTTGGAGACAACATGTATCGTGTGACTGA
CATCTTCCGCACAGTCATATCCATCACCACTGAATTACAACCATTTTCCCAAGTCCTGCTGCACCTCAGTCAATG
AAGTCATATGCCACGGGATTCCCGACAAACGGCCATTGGTGGATGGTGACATTCTCAACATCGACATTTCTCTTT
ACCACGAGGGATATCACGCCGACCTGAACGAAACTTACTACATTGGCGAAGAGGCAGCCAAAGATCCTGAAAATA
TCCGGGTTGTCGAAGCAGCACGACAGTGTCTAGAGGCGGCAATTCAAGCCGTGAAGCCAGGAGTTCCGATACGCG
AGTTCGGCAACATCATTGAGAAACACGCCAAAACGCAAAACTGCAGCGTCATCCGAACATATTGCGGGCACGGAG
TCAATACTCTCTTCCACTGCGCTCCTAACGTACCGCATTACGCCAAAAATAAGGCGGTGGGCGAATGCAAGCCGG
GAATGACTTTCACCATTGAGCCGATGATAGCGTTGGGTAAGTACCGCGACATGACCTGGCCAGACAACTGGACCA
GCACTACAATTGACGGAAAGCGGACAGCGCAGTTTGGTAGGTAATCTGAAGTCAGTCAGTTCCCTGGCGGATGCC
AAATGCTAAAACAATCTCACAGAGCATACTCTCCTCGTCACCGAAGATGGAGTGGAGATTCTTACTGCGAGAAAC
AAGGATTCGCCCGGGGGCCCCGTCATGATGCCCGGCGAGATTCAAGCAGTACAAACGTTCAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail