Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04279
Gene name
Locationscaffold_04:2740596..2742136
Strand-
Gene length (bp)1540
Transcript length (bp)1470
Coding sequence length (bp)1470
Protein length (aa) 490

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08572 PRP3 pre-mRNA processing factor 3 (PRP3) 1.1E-69 107 322
PF06544 DUF1115 Protein of unknown function (DUF1115) 6.8E-46 346 485

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4379 0.651 0.0223 0.0175 0.1322 0.0103 0.0128 0.0195 0.0182 0.0041

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5368
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3325
Ophiocordyceps australis map64 (Brazil) OphauB2|2494
Ophiocordyceps camponoti-floridani Ophcf2|04279 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2100
Ophiocordyceps kimflemingae Ophio5|1131
Ophiocordyceps subramaniannii Hirsu2|5362

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04279
MDTRPAGLGPRLDVTSRVQKPSSAAEKKAALKARVAAAIGTSRSKGGLNVGLHPALEDLSSWKSQSKSGDNPKTQ
NTPPPKSLSNPGSQNVHLKGNARLGIGNKGSNPYFDEASATQATGSRNREPKRLVFNQKGKYIQQAAALRRQADL
EAMKKRIAEQTRRAGIDDDLDVEKNFVPDPPPDIEWWDEGLLDGRNYDHIEDPTKLKLNTADSIVTEYIQHPVAL
KPPQDRNQTPAKPMFLTSKEQAKLRRQRRTAELKELQAKIRVGFIAAPPPKVKKANLMRVLGDVAVKDPTAVEAR
VNREIEERQQKHMQTNEERKLTKAQKHDKLTKNQLTDANKGIHIQAFKITTLANGQHRYKIGVNAEQLALTGICI
MNPKHNLVIVEGGSWSIDKFRKLMLQRIKWTENSPAPKSESNRASAHNWLRAESDDGELKDISLNECKLIFSGEQ
KARAFRKWSSKVCETDVEARETLARVKMENFWSLAKNFC*
Coding >Ophcf2|04279
ATGGACACGCGTCCCGCGGGCCTCGGCCCTCGGCTTGACGTCACGTCCCGAGTTCAAAAGCCATCCTCGGCGGCC
GAGAAGAAAGCCGCCCTCAAGGCTCGCGTCGCCGCTGCCATAGGCACGAGCAGATCGAAGGGCGGCTTGAACGTT
GGGCTTCATCCAGCTCTAGAGGATCTTAGCTCCTGGAAGTCTCAGAGCAAATCCGGAGACAACCCAAAAACTCAA
AATACTCCGCCGCCCAAGTCTCTCTCAAATCCAGGCTCGCAAAATGTCCACCTAAAGGGAAATGCTCGTCTCGGT
ATTGGCAACAAGGGTAGTAACCCATACTTCGACGAAGCTTCTGCGACACAGGCGACGGGATCTAGGAATCGTGAG
CCCAAGAGACTGGTGTTCAACCAAAAGGGGAAATATATTCAGCAGGCTGCCGCTCTACGTCGGCAAGCTGATCTC
GAGGCAATGAAGAAGCGGATAGCGGAACAGACCAGGAGAGCAGGCATTGACGACGACCTTGATGTTGAGAAGAAC
TTTGTTCCTGATCCTCCACCTGATATTGAGTGGTGGGACGAGGGCTTACTGGATGGACGGAATTACGACCACATC
GAAGATCCAACAAAGTTAAAACTGAACACTGCGGACAGCATCGTGACCGAATACATACAGCATCCAGTCGCGCTC
AAGCCACCTCAGGATCGTAACCAAACCCCAGCGAAGCCGATGTTCCTGACCTCCAAGGAACAGGCAAAACTTCGA
CGGCAAAGAAGGACTGCCGAGTTGAAGGAATTGCAGGCCAAAATTAGAGTTGGCTTTATTGCAGCACCTCCCCCG
AAAGTGAAGAAAGCAAACCTGATGCGCGTTCTCGGGGATGTTGCTGTCAAAGACCCCACCGCGGTGGAGGCCAGA
GTGAATCGCGAAATCGAAGAACGACAACAGAAACACATGCAAACGAACGAAGAACGGAAATTGACCAAGGCGCAG
AAGCATGACAAGCTTACTAAGAATCAACTCACAGACGCCAATAAGGGCATTCATATCCAAGCTTTCAAGATTACG
ACATTGGCCAACGGGCAGCACCGTTACAAGATTGGAGTAAATGCCGAGCAACTAGCGTTGACTGGAATCTGCATA
ATGAACCCGAAACATAATCTTGTCATCGTGGAAGGGGGGTCATGGAGCATCGATAAGTTCAGAAAGCTCATGCTT
CAACGGATCAAATGGACCGAAAACTCACCTGCCCCCAAGTCTGAGAGTAATCGGGCCTCGGCGCATAATTGGCTT
CGAGCAGAGAGCGACGACGGAGAGCTCAAAGATATATCGTTGAACGAGTGCAAGCTCATCTTTTCGGGCGAGCAA
AAAGCGCGGGCATTCAGAAAATGGAGCAGCAAGGTTTGCGAGACTGACGTCGAGGCGCGGGAGACTTTGGCCCGC
GTCAAGATGGAGAATTTCTGGTCTTTGGCCAAGAACTTTTGTTGA
Transcript >Ophcf2|04279
ATGGACACGCGTCCCGCGGGCCTCGGCCCTCGGCTTGACGTCACGTCCCGAGTTCAAAAGCCATCCTCGGCGGCC
GAGAAGAAAGCCGCCCTCAAGGCTCGCGTCGCCGCTGCCATAGGCACGAGCAGATCGAAGGGCGGCTTGAACGTT
GGGCTTCATCCAGCTCTAGAGGATCTTAGCTCCTGGAAGTCTCAGAGCAAATCCGGAGACAACCCAAAAACTCAA
AATACTCCGCCGCCCAAGTCTCTCTCAAATCCAGGCTCGCAAAATGTCCACCTAAAGGGAAATGCTCGTCTCGGT
ATTGGCAACAAGGGTAGTAACCCATACTTCGACGAAGCTTCTGCGACACAGGCGACGGGATCTAGGAATCGTGAG
CCCAAGAGACTGGTGTTCAACCAAAAGGGGAAATATATTCAGCAGGCTGCCGCTCTACGTCGGCAAGCTGATCTC
GAGGCAATGAAGAAGCGGATAGCGGAACAGACCAGGAGAGCAGGCATTGACGACGACCTTGATGTTGAGAAGAAC
TTTGTTCCTGATCCTCCACCTGATATTGAGTGGTGGGACGAGGGCTTACTGGATGGACGGAATTACGACCACATC
GAAGATCCAACAAAGTTAAAACTGAACACTGCGGACAGCATCGTGACCGAATACATACAGCATCCAGTCGCGCTC
AAGCCACCTCAGGATCGTAACCAAACCCCAGCGAAGCCGATGTTCCTGACCTCCAAGGAACAGGCAAAACTTCGA
CGGCAAAGAAGGACTGCCGAGTTGAAGGAATTGCAGGCCAAAATTAGAGTTGGCTTTATTGCAGCACCTCCCCCG
AAAGTGAAGAAAGCAAACCTGATGCGCGTTCTCGGGGATGTTGCTGTCAAAGACCCCACCGCGGTGGAGGCCAGA
GTGAATCGCGAAATCGAAGAACGACAACAGAAACACATGCAAACGAACGAAGAACGGAAATTGACCAAGGCGCAG
AAGCATGACAAGCTTACTAAGAATCAACTCACAGACGCCAATAAGGGCATTCATATCCAAGCTTTCAAGATTACG
ACATTGGCCAACGGGCAGCACCGTTACAAGATTGGAGTAAATGCCGAGCAACTAGCGTTGACTGGAATCTGCATA
ATGAACCCGAAACATAATCTTGTCATCGTGGAAGGGGGGTCATGGAGCATCGATAAGTTCAGAAAGCTCATGCTT
CAACGGATCAAATGGACCGAAAACTCACCTGCCCCCAAGTCTGAGAGTAATCGGGCCTCGGCGCATAATTGGCTT
CGAGCAGAGAGCGACGACGGAGAGCTCAAAGATATATCGTTGAACGAGTGCAAGCTCATCTTTTCGGGCGAGCAA
AAAGCGCGGGCATTCAGAAAATGGAGCAGCAAGGTTTGCGAGACTGACGTCGAGGCGCGGGAGACTTTGGCCCGC
GTCAAGATGGAGAATTTCTGGTCTTTGGCCAAGAACTTTTGTTGA
Gene >Ophcf2|04279
ATGGACACGCGTCCCGCGGGCCTCGGCCCTCGGCTTGACGTCACGTCCCGAGTTCAAAAGCCATCCTCGGCGGCC
GAGAAGAAAGCCGCCCTCAAGGCTCGCGTCGCCGCTGCCATAGGCACGAGCAGATCGAAGGGCGGCTTGAACGTT
GGGCTTCATCCAGCTCTAGAGGATCTTAGCTCCTGGAAGTCTCAGAGCAAATCCGGAGACAACCCAAAAACTCAA
AATACTCCGCCGCCCAAGTCTCTCTCAAATCCAGGCTCGCAAAATGTCCACCTAAAGGGAAATGCTCGTCTCGGT
ATTGGCAACAAGGGTAGTAACCCATACTTCGACGAAGCTTCTGCGACACAGGCGACGGGATCTAGGAATCGTGAG
CCCAAGAGACTGGTGTTCAACCAAAAGGGGAAATATATTCAGCAGGCTGCCGCTCTACGTCGGCAAGCTGATCTC
GAGGCAATGAAGAAGCGGATAGCGGAACAGACCAGGAGAGCAGGCATTGACGACGACCTTGATGTTGAGAAGAAC
TTTGTTCCTGATCCTCCACCTGATATTGAGTGGTGGGACGAGGGCTTACTGGATGGACGGAATTACGACCACATC
GAAGATCCAACAAAGTTAAAACTGAACACTGCGGACAGCATCGTGACCGAATACATACAGCATCCAGTCGCGCTC
AAGCCACCTCAGGATCGTAACCAAACCCCAGCGAAGCCGATGTTCCTGACCTCCAAGGAACAGGCAAAACTTCGA
CGGCAAAGAAGGACTGCCGAGTTGAAGGAATTGCAGGCCAAAATTAGAGTTGGCTTTATTGCAGCACCTCCCCCG
AAAGTGAAGAAAGCAAACCTGATGCGCGTTCTCGGGGATGGTTAGTTCTTCCCACACTGACTGTTGGTGGATGCC
AGGGTGGAAGATCCTAGGCGCTGACACTGCTGCAGTTGCTGTCAAAGACCCCACCGCGGTGGAGGCCAGAGTGAA
TCGCGAAATCGAAGAACGACAACAGAAACACATGCAAACGAACGAAGAACGGAAATTGACCAAGGCGCAGAAGCA
TGACAAGCTTACTAAGAATCAACTCACAGACGCCAATAAGGGCATTCATATCCAAGCTTTCAAGATTACGACATT
GGCCAACGGGCAGCACCGTTACAAGATTGGAGTAAATGCCGAGCAACTAGCGTTGACTGGAATCTGCATAATGAA
CCCGAAACATAATCTTGTCATCGTGGAAGGGGGGTCATGGAGCATCGATAAGTTCAGAAAGCTCATGCTTCAACG
GATCAAATGGACCGAAAACTCACCTGCCCCCAAGTCTGAGAGTAATCGGGCCTCGGCGCATAATTGGCTTCGAGC
AGAGAGCGACGACGGAGAGCTCAAAGATATATCGTTGAACGAGTGCAAGCTCATCTTTTCGGGCGAGCAAAAAGC
GCGGGCATTCAGAAAATGGAGCAGCAAGGTTTGCGAGACTGACGTCGAGGCGCGGGAGACTTTGGCCCGCGTCAA
GATGGAGAATTTCTGGTCTTTGGCCAAGAACTTTTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail