Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04274
Gene name
Locationscaffold_04:2551854..2556614
Strand+
Gene length (bp)4760
Transcript length (bp)4698
Coding sequence length (bp)4698
Protein length (aa) 1566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00275 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) 2.3E-125 405 831
PF01761 DHQ_synthase 3-dehydroquinate synthase 6.9E-101 79 357
PF01487 DHquinase_I Type I 3-dehydroquinase 1.5E-55 1052 1271
PF01202 SKI Shikimate kinase 1.6E-34 867 1011
PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain 9.9E-23 1285 1365
PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain 1.5E-07 1534 1563
PF13685 Fe-ADH_2 Iron-containing alcohol dehydrogenase 1.7E-06 34 291

GO

GO Term Description Terminal node
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0003855 3-dehydroquinate dehydratase activity Yes
GO:0004764 shikimate 3-dehydrogenase (NADP+) activity Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016829 lyase activity No
GO:0003824 catalytic activity No
GO:0016835 carbon-oxygen lyase activity No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0016836 hydro-lyase activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 109 131 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04274
MAQFEDRLPETISILGKASIIADYALWPGAVATDLCRDSPASTYVLITDTNLHDIYVPPFRDFFDSHRDEKTTRQ
LLTYAVPPGEASKCREIKAEIEDWMLSQSCTRDTVLIALGGGVIGDMIGYVAATFMRGIRFVQVPTTLLAMVDSS
IGGKTAIDTPMGKNLVGAFWQPRRIYIDLKFLDTLPPREFFNGMSEVIKTAAIWNEAEFAFLEQQAADIVTCASS
TAKNRLQPVKEAVKRIVVNAARVKADVVTRDEREGGLRNLLNFGHSIGHAIEAILAPQILHGEAVAIGMVKEAEL
ARFVGVLRPHAVARLSKCIASFGLPTSLHDKQVVKLTAGKQCQVEEMLRKMSVDKKNDGEQKKVVLLSTIGKTHE
DKASVVDDSSIKLILSSSVRVTPGVPPNWQVTVTPPGSKSISNRALIMAALGSGRCRLKNLLHSDDTEYMLSAIT
RLRGASFSWKDAGEVLEVHGRAGQLQASKDDLYIGNAGTASRFLATVVALCQPADGIKHTILTGNDRMKTRPIGP
LVDALRSNGVDVEYLELDKSLPLRVHAAGGFDGGLIELAATVSSQYVSSILMAAPFAKKPVTLRLVGGKPVSQPY
IDMTISMMLSFGLVVTRSDLETNTYHIPQGVYRNPLEYTIESDASSATYPLAVAAITGMTCIVPNIGSQSLQGDA
RFAVDILRPMGCLVEQDEVSTKVTGPPVGTLRGLPHVDMEPMTDAFLTASVLAAVAQGKTQITGIANQRVKECNR
IKAMVDELSKFGVKCSELEDGIEIYGDSLTGMRSADATIHCYDDHRVAMSFSVLAVASPGATVITQRECVGKTWP
GWWDTLKESFGVTLAGVDETSDHQRTPGDGDAELSIFVIGMRGAGKTTTGQWMASLLGWEFFDLDQELEKRSRKS
IIEMVSGSSQWEGFRQAELELLRDTMTSQPQRHVFACGGGVVETPQARDLLTAHCRRGGYVVLVHRSLDQIVDYL
KQDESRPAYASDVREVYQRRKLWYEQCSNYVYFSPHSGSSGSVEEIPDDLELFTVSMRGRSGRSDVMAAKGKPSF
FISLTLPNLFKGRELIPRVVDGADAVELRVDLLEDQSPEAVLEQVSILRSSARRPIIFTVRTQSQGGQFPDDAVG
ELQTLYRLAMRMAVEYLDVEVTATDETIQIVTDLRGHTQIIASHHDPQGNLTWKNASWIPFYNRALQFGNIIKLV
GTARNLDDNYQLASFKSRMLASQEIPIIAINMGSMGKLSRILNGFLTPVTHPDLPFPAAPGQLSATEIRQGLTLL
GQIDAKVFYLFGNPISQSRSPTIHNHLFRRMGLPHCYELRETDDVAQVQQVLQSSAFGGASVTIPLKRHVMALVD
ELTPAAKIIGAINTIIPIAKARSSHRPHLLGDNTDWKGIVRTLRQSGASTQKNGACAMVVGSGGTTRAAVYALRS
MGYCPIYVIARDSSKALDLAAGFPSDYNIEVMATHSEFANKKACPSVIINTIPGDTPIDSKVKEVLVGTFNTTEQ
QANCRVLVEMAYKPRVTPVMELAGAAGGWRVVPGLEPLVSQGCYQFELWTGIIPSQDAAREALGP*
Coding >Ophcf2|04274
ATGGCGCAGTTCGAAGACCGCTTGCCTGAAACGATATCTATCCTGGGTAAAGCCAGCATCATTGCCGACTACGCT
CTTTGGCCCGGAGCAGTCGCAACAGACCTTTGCCGGGACTCACCGGCTTCCACATATGTTCTCATAACCGACACG
AATCTGCACGATATCTACGTGCCCCCTTTTCGGGATTTCTTCGACAGCCATCGGGATGAAAAGACTACTCGTCAG
TTATTGACGTACGCAGTTCCACCCGGTGAAGCCTCAAAATGCCGCGAAATCAAGGCAGAGATCGAGGACTGGATG
TTGTCCCAAAGCTGCACCCGAGATACTGTCCTGATAGCTCTCGGTGGTGGAGTCATTGGTGACATGATCGGATAT
GTTGCTGCAACTTTCATGCGAGGCATTCGCTTCGTTCAGGTACCGACAACTCTGCTTGCCATGGTTGACTCGTCT
ATTGGAGGCAAGACCGCCATCGACACGCCCATGGGCAAGAATTTGGTTGGAGCCTTTTGGCAGCCGCGCCGCATT
TACATTGATCTGAAATTCTTAGATACGCTTCCTCCACGCGAATTTTTCAACGGTATGTCGGAGGTGATCAAAACG
GCCGCCATCTGGAACGAAGCCGAGTTTGCTTTCCTGGAGCAACAAGCCGCAGATATTGTAACGTGTGCTTCTTCA
ACTGCGAAAAACCGTCTCCAGCCGGTCAAAGAAGCCGTGAAGCGAATTGTCGTCAACGCGGCACGTGTCAAAGCC
GACGTTGTCACCAGAGATGAGCGAGAAGGCGGCTTGCGCAATCTCCTCAATTTTGGACACTCCATCGGCCACGCA
ATAGAGGCCATCCTGGCCCCCCAGATTCTTCACGGCGAAGCAGTTGCTATTGGGATGGTCAAGGAGGCAGAATTG
GCCCGCTTCGTTGGCGTTCTCCGTCCCCATGCCGTGGCCAGACTTTCTAAATGCATTGCGTCGTTTGGGCTCCCT
ACATCTTTGCATGACAAGCAGGTTGTCAAGTTAACTGCAGGCAAGCAGTGTCAAGTGGAAGAGATGCTGCGAAAG
ATGTCGGTTGACAAGAAGAACGACGGCGAACAGAAGAAAGTGGTGCTGTTATCTACCATCGGCAAGACTCATGAA
GACAAAGCCAGTGTGGTGGATGACAGTTCCATCAAACTGATCTTGAGTTCCTCCGTCCGAGTTACACCTGGCGTG
CCTCCAAATTGGCAGGTCACCGTCACTCCGCCCGGTTCCAAAAGCATCTCCAACCGGGCGTTGATCATGGCGGCT
CTCGGATCCGGCCGCTGCCGCTTGAAAAACCTGCTGCACTCTGACGACACAGAGTATATGCTATCCGCAATCACA
CGTCTTCGTGGCGCATCTTTCTCTTGGAAGGACGCTGGTGAGGTGCTCGAGGTTCATGGCAGAGCCGGCCAATTG
CAAGCTAGCAAGGACGACCTATACATTGGCAATGCCGGCACAGCATCTCGATTTCTCGCCACCGTCGTCGCCCTC
TGTCAACCTGCAGATGGTATCAAACACACGATTCTTACTGGCAATGATCGCATGAAGACCCGGCCGATAGGTCCC
CTTGTCGATGCGTTGCGATCGAACGGAGTCGATGTCGAGTATCTCGAGCTGGACAAAAGTCTTCCGCTTCGTGTC
CACGCTGCCGGTGGTTTCGACGGAGGACTCATCGAACTAGCTGCGACTGTGTCCTCCCAGTACGTCTCGTCTATA
CTGATGGCCGCGCCATTTGCCAAGAAGCCCGTTACTCTTCGCTTGGTCGGGGGCAAACCGGTCTCCCAACCCTAT
ATTGACATGACGATTTCCATGATGCTTTCGTTTGGGCTGGTAGTCACCAGGTCCGATTTGGAAACCAACACCTAC
CACATCCCCCAGGGTGTATACCGCAACCCCCTGGAGTACACGATTGAGAGTGACGCAAGCTCGGCCACCTACCCG
CTTGCTGTGGCTGCAATCACTGGGATGACCTGTATCGTCCCAAATATTGGATCTCAGTCTCTCCAAGGCGATGCA
CGGTTCGCCGTGGATATCTTGAGACCAATGGGCTGTCTCGTTGAACAGGACGAGGTTTCCACGAAAGTTACAGGG
CCGCCAGTTGGAACATTGCGGGGACTTCCGCACGTGGACATGGAGCCCATGACGGATGCCTTCCTAACAGCTTCG
GTACTGGCAGCAGTTGCACAAGGCAAGACGCAAATCACAGGCATCGCAAATCAGAGAGTCAAAGAATGCAATAGA
ATCAAGGCCATGGTGGATGAGCTTTCCAAATTTGGGGTCAAATGCTCGGAACTTGAAGATGGCATCGAGATATAT
GGCGATTCGCTGACAGGCATGCGGTCCGCAGATGCGACGATCCATTGCTACGACGATCATCGCGTCGCCATGAGC
TTCAGCGTCTTGGCCGTTGCTTCGCCAGGTGCTACCGTCATCACGCAACGCGAGTGTGTGGGGAAGACCTGGCCT
GGATGGTGGGATACGCTCAAGGAGTCTTTCGGTGTCACTTTGGCGGGCGTCGATGAAACCTCGGACCATCAGCGT
ACGCCTGGTGACGGCGACGCCGAACTCTCGATATTCGTCATCGGGATGAGAGGCGCAGGGAAGACAACGACTGGG
CAGTGGATGGCGTCTCTACTGGGCTGGGAATTCTTCGACTTGGACCAAGAACTTGAAAAGCGGTCGCGTAAATCT
ATCATTGAGATGGTCAGTGGATCAAGTCAATGGGAGGGTTTTCGCCAGGCAGAGCTGGAATTGTTACGCGACACA
ATGACAAGTCAACCCCAGCGTCATGTCTTCGCTTGTGGCGGGGGAGTTGTGGAAACTCCACAAGCAAGAGATCTG
TTGACGGCGCATTGCCGCCGAGGTGGTTACGTCGTCCTCGTTCACCGCAGCCTTGACCAGATTGTGGACTACTTA
AAGCAGGACGAGTCTCGACCGGCTTACGCAAGTGATGTTCGCGAAGTCTATCAGCGACGGAAGCTGTGGTACGAG
CAGTGCAGTAATTACGTTTATTTCAGCCCTCATTCAGGCAGTTCCGGCAGTGTTGAGGAAATACCTGATGACCTG
GAACTCTTTACGGTCTCCATGCGCGGAAGGAGCGGTCGGTCGGATGTCATGGCTGCCAAGGGAAAGCCCAGCTTC
TTCATTTCACTCACGCTGCCCAACCTCTTCAAGGGGCGAGAGTTGATCCCTCGCGTCGTTGACGGGGCTGATGCT
GTCGAGCTTCGCGTGGATCTCCTGGAAGATCAAAGCCCAGAAGCGGTCCTCGAGCAGGTATCTATCCTGCGTTCC
TCGGCCAGGAGGCCGATCATTTTCACTGTCCGCACCCAGTCCCAGGGGGGACAATTTCCCGACGACGCAGTTGGA
GAGCTCCAGACTCTTTATCGTTTAGCAATGCGGATGGCCGTAGAGTACCTTGACGTTGAGGTGACGGCCACTGAC
GAAACAATTCAAATAGTGACAGACCTGCGCGGACACACGCAGATCATTGCCTCGCATCACGATCCGCAAGGTAAC
TTAACCTGGAAGAATGCCTCGTGGATTCCTTTTTATAATAGGGCTTTGCAATTCGGAAACATCATCAAACTCGTC
GGCACTGCCCGGAATTTGGACGATAATTACCAACTGGCGAGCTTCAAGTCCAGAATGCTTGCCTCGCAGGAGATC
CCGATCATTGCGATTAATATGGGTTCTATGGGAAAGCTCAGCCGTATCTTGAACGGGTTCCTTACCCCCGTTACC
CATCCAGATCTGCCGTTCCCAGCTGCGCCAGGCCAATTGTCGGCCACCGAGATCCGTCAAGGCTTGACGCTGCTC
GGCCAAATCGACGCAAAAGTTTTTTATCTCTTTGGCAACCCGATCTCGCAGTCAAGATCGCCTACCATTCACAAC
CACCTCTTTCGACGGATGGGTCTGCCGCATTGTTACGAGCTGCGGGAGACCGACGATGTCGCTCAAGTGCAGCAG
GTGTTGCAGTCTTCAGCGTTCGGGGGAGCATCCGTCACCATACCCCTGAAGCGTCATGTCATGGCTCTGGTCGAC
GAACTAACACCGGCTGCCAAGATCATTGGCGCGATCAATACCATCATTCCGATTGCAAAGGCGAGGTCAAGCCAT
CGTCCTCACCTTCTCGGTGACAACACCGACTGGAAGGGCATTGTCCGGACGCTGAGGCAGAGCGGAGCATCGACG
CAGAAAAACGGGGCTTGCGCGATGGTGGTTGGATCTGGAGGGACGACGAGGGCTGCTGTTTATGCCCTCCGCTCG
ATGGGTTATTGTCCAATCTACGTCATAGCGCGGGATTCGAGTAAGGCTTTGGACCTGGCAGCCGGTTTCCCAAGC
GACTACAATATCGAAGTCATGGCCACCCATTCGGAGTTTGCGAACAAGAAAGCCTGCCCGAGCGTCATCATCAAC
ACCATTCCAGGTGACACACCGATAGACTCAAAGGTGAAGGAGGTCCTTGTCGGCACTTTCAATACTACAGAACAG
CAGGCTAATTGTCGGGTCCTGGTCGAAATGGCTTACAAGCCTCGCGTGACTCCCGTCATGGAGCTTGCTGGTGCT
GCCGGCGGATGGAGAGTGGTTCCGGGGCTCGAGCCGCTGGTATCCCAAGGATGCTACCAGTTTGAGCTTTGGACT
GGCATAATACCTTCACAAGACGCTGCGCGCGAAGCCTTGGGTCCGTAG
Transcript >Ophcf2|04274
ATGGCGCAGTTCGAAGACCGCTTGCCTGAAACGATATCTATCCTGGGTAAAGCCAGCATCATTGCCGACTACGCT
CTTTGGCCCGGAGCAGTCGCAACAGACCTTTGCCGGGACTCACCGGCTTCCACATATGTTCTCATAACCGACACG
AATCTGCACGATATCTACGTGCCCCCTTTTCGGGATTTCTTCGACAGCCATCGGGATGAAAAGACTACTCGTCAG
TTATTGACGTACGCAGTTCCACCCGGTGAAGCCTCAAAATGCCGCGAAATCAAGGCAGAGATCGAGGACTGGATG
TTGTCCCAAAGCTGCACCCGAGATACTGTCCTGATAGCTCTCGGTGGTGGAGTCATTGGTGACATGATCGGATAT
GTTGCTGCAACTTTCATGCGAGGCATTCGCTTCGTTCAGGTACCGACAACTCTGCTTGCCATGGTTGACTCGTCT
ATTGGAGGCAAGACCGCCATCGACACGCCCATGGGCAAGAATTTGGTTGGAGCCTTTTGGCAGCCGCGCCGCATT
TACATTGATCTGAAATTCTTAGATACGCTTCCTCCACGCGAATTTTTCAACGGTATGTCGGAGGTGATCAAAACG
GCCGCCATCTGGAACGAAGCCGAGTTTGCTTTCCTGGAGCAACAAGCCGCAGATATTGTAACGTGTGCTTCTTCA
ACTGCGAAAAACCGTCTCCAGCCGGTCAAAGAAGCCGTGAAGCGAATTGTCGTCAACGCGGCACGTGTCAAAGCC
GACGTTGTCACCAGAGATGAGCGAGAAGGCGGCTTGCGCAATCTCCTCAATTTTGGACACTCCATCGGCCACGCA
ATAGAGGCCATCCTGGCCCCCCAGATTCTTCACGGCGAAGCAGTTGCTATTGGGATGGTCAAGGAGGCAGAATTG
GCCCGCTTCGTTGGCGTTCTCCGTCCCCATGCCGTGGCCAGACTTTCTAAATGCATTGCGTCGTTTGGGCTCCCT
ACATCTTTGCATGACAAGCAGGTTGTCAAGTTAACTGCAGGCAAGCAGTGTCAAGTGGAAGAGATGCTGCGAAAG
ATGTCGGTTGACAAGAAGAACGACGGCGAACAGAAGAAAGTGGTGCTGTTATCTACCATCGGCAAGACTCATGAA
GACAAAGCCAGTGTGGTGGATGACAGTTCCATCAAACTGATCTTGAGTTCCTCCGTCCGAGTTACACCTGGCGTG
CCTCCAAATTGGCAGGTCACCGTCACTCCGCCCGGTTCCAAAAGCATCTCCAACCGGGCGTTGATCATGGCGGCT
CTCGGATCCGGCCGCTGCCGCTTGAAAAACCTGCTGCACTCTGACGACACAGAGTATATGCTATCCGCAATCACA
CGTCTTCGTGGCGCATCTTTCTCTTGGAAGGACGCTGGTGAGGTGCTCGAGGTTCATGGCAGAGCCGGCCAATTG
CAAGCTAGCAAGGACGACCTATACATTGGCAATGCCGGCACAGCATCTCGATTTCTCGCCACCGTCGTCGCCCTC
TGTCAACCTGCAGATGGTATCAAACACACGATTCTTACTGGCAATGATCGCATGAAGACCCGGCCGATAGGTCCC
CTTGTCGATGCGTTGCGATCGAACGGAGTCGATGTCGAGTATCTCGAGCTGGACAAAAGTCTTCCGCTTCGTGTC
CACGCTGCCGGTGGTTTCGACGGAGGACTCATCGAACTAGCTGCGACTGTGTCCTCCCAGTACGTCTCGTCTATA
CTGATGGCCGCGCCATTTGCCAAGAAGCCCGTTACTCTTCGCTTGGTCGGGGGCAAACCGGTCTCCCAACCCTAT
ATTGACATGACGATTTCCATGATGCTTTCGTTTGGGCTGGTAGTCACCAGGTCCGATTTGGAAACCAACACCTAC
CACATCCCCCAGGGTGTATACCGCAACCCCCTGGAGTACACGATTGAGAGTGACGCAAGCTCGGCCACCTACCCG
CTTGCTGTGGCTGCAATCACTGGGATGACCTGTATCGTCCCAAATATTGGATCTCAGTCTCTCCAAGGCGATGCA
CGGTTCGCCGTGGATATCTTGAGACCAATGGGCTGTCTCGTTGAACAGGACGAGGTTTCCACGAAAGTTACAGGG
CCGCCAGTTGGAACATTGCGGGGACTTCCGCACGTGGACATGGAGCCCATGACGGATGCCTTCCTAACAGCTTCG
GTACTGGCAGCAGTTGCACAAGGCAAGACGCAAATCACAGGCATCGCAAATCAGAGAGTCAAAGAATGCAATAGA
ATCAAGGCCATGGTGGATGAGCTTTCCAAATTTGGGGTCAAATGCTCGGAACTTGAAGATGGCATCGAGATATAT
GGCGATTCGCTGACAGGCATGCGGTCCGCAGATGCGACGATCCATTGCTACGACGATCATCGCGTCGCCATGAGC
TTCAGCGTCTTGGCCGTTGCTTCGCCAGGTGCTACCGTCATCACGCAACGCGAGTGTGTGGGGAAGACCTGGCCT
GGATGGTGGGATACGCTCAAGGAGTCTTTCGGTGTCACTTTGGCGGGCGTCGATGAAACCTCGGACCATCAGCGT
ACGCCTGGTGACGGCGACGCCGAACTCTCGATATTCGTCATCGGGATGAGAGGCGCAGGGAAGACAACGACTGGG
CAGTGGATGGCGTCTCTACTGGGCTGGGAATTCTTCGACTTGGACCAAGAACTTGAAAAGCGGTCGCGTAAATCT
ATCATTGAGATGGTCAGTGGATCAAGTCAATGGGAGGGTTTTCGCCAGGCAGAGCTGGAATTGTTACGCGACACA
ATGACAAGTCAACCCCAGCGTCATGTCTTCGCTTGTGGCGGGGGAGTTGTGGAAACTCCACAAGCAAGAGATCTG
TTGACGGCGCATTGCCGCCGAGGTGGTTACGTCGTCCTCGTTCACCGCAGCCTTGACCAGATTGTGGACTACTTA
AAGCAGGACGAGTCTCGACCGGCTTACGCAAGTGATGTTCGCGAAGTCTATCAGCGACGGAAGCTGTGGTACGAG
CAGTGCAGTAATTACGTTTATTTCAGCCCTCATTCAGGCAGTTCCGGCAGTGTTGAGGAAATACCTGATGACCTG
GAACTCTTTACGGTCTCCATGCGCGGAAGGAGCGGTCGGTCGGATGTCATGGCTGCCAAGGGAAAGCCCAGCTTC
TTCATTTCACTCACGCTGCCCAACCTCTTCAAGGGGCGAGAGTTGATCCCTCGCGTCGTTGACGGGGCTGATGCT
GTCGAGCTTCGCGTGGATCTCCTGGAAGATCAAAGCCCAGAAGCGGTCCTCGAGCAGGTATCTATCCTGCGTTCC
TCGGCCAGGAGGCCGATCATTTTCACTGTCCGCACCCAGTCCCAGGGGGGACAATTTCCCGACGACGCAGTTGGA
GAGCTCCAGACTCTTTATCGTTTAGCAATGCGGATGGCCGTAGAGTACCTTGACGTTGAGGTGACGGCCACTGAC
GAAACAATTCAAATAGTGACAGACCTGCGCGGACACACGCAGATCATTGCCTCGCATCACGATCCGCAAGGTAAC
TTAACCTGGAAGAATGCCTCGTGGATTCCTTTTTATAATAGGGCTTTGCAATTCGGAAACATCATCAAACTCGTC
GGCACTGCCCGGAATTTGGACGATAATTACCAACTGGCGAGCTTCAAGTCCAGAATGCTTGCCTCGCAGGAGATC
CCGATCATTGCGATTAATATGGGTTCTATGGGAAAGCTCAGCCGTATCTTGAACGGGTTCCTTACCCCCGTTACC
CATCCAGATCTGCCGTTCCCAGCTGCGCCAGGCCAATTGTCGGCCACCGAGATCCGTCAAGGCTTGACGCTGCTC
GGCCAAATCGACGCAAAAGTTTTTTATCTCTTTGGCAACCCGATCTCGCAGTCAAGATCGCCTACCATTCACAAC
CACCTCTTTCGACGGATGGGTCTGCCGCATTGTTACGAGCTGCGGGAGACCGACGATGTCGCTCAAGTGCAGCAG
GTGTTGCAGTCTTCAGCGTTCGGGGGAGCATCCGTCACCATACCCCTGAAGCGTCATGTCATGGCTCTGGTCGAC
GAACTAACACCGGCTGCCAAGATCATTGGCGCGATCAATACCATCATTCCGATTGCAAAGGCGAGGTCAAGCCAT
CGTCCTCACCTTCTCGGTGACAACACCGACTGGAAGGGCATTGTCCGGACGCTGAGGCAGAGCGGAGCATCGACG
CAGAAAAACGGGGCTTGCGCGATGGTGGTTGGATCTGGAGGGACGACGAGGGCTGCTGTTTATGCCCTCCGCTCG
ATGGGTTATTGTCCAATCTACGTCATAGCGCGGGATTCGAGTAAGGCTTTGGACCTGGCAGCCGGTTTCCCAAGC
GACTACAATATCGAAGTCATGGCCACCCATTCGGAGTTTGCGAACAAGAAAGCCTGCCCGAGCGTCATCATCAAC
ACCATTCCAGGTGACACACCGATAGACTCAAAGGTGAAGGAGGTCCTTGTCGGCACTTTCAATACTACAGAACAG
CAGGCTAATTGTCGGGTCCTGGTCGAAATGGCTTACAAGCCTCGCGTGACTCCCGTCATGGAGCTTGCTGGTGCT
GCCGGCGGATGGAGAGTGGTTCCGGGGCTCGAGCCGCTGGTATCCCAAGGATGCTACCAGTTTGAGCTTTGGACT
GGCATAATACCTTCACAAGACGCTGCGCGCGAAGCCTTGGGTCCGTAG
Gene >Ophcf2|04274
ATGGCGCAGTTCGAAGACCGCTTGCCTGAAACGATATCTATCCTGGGTAAAGCCAGCATCATTGCCGACTACGCT
CTTTGGCCCGGAGCAGTCGCAACAGACCTTTGCCGGGACTCACCGGCTTCCACATATGTTCTCATAACCGACACG
AATCTGCACGATATCTACGTGCCCCCTTTTCGGGATTTCTTCGACAGCCATCGGGATGAAAAGACTACTCGTCAG
TTATTGACGTACGCAGTTCCACCCGGTGAAGCCTCAAAATGCCGCGAAATCAAGGCAGAGATCGAGGACTGGATG
TTGTCCCAAAGCTGCACCCGAGATACTGTCCTGATAGCTCTCGGTGGTGGAGTCATTGGTGACATGATCGGATAT
GTTGCTGCAACTTTCATGCGAGGCATTCGCTTCGTTCAGGTACCGACAACTCTGCTTGCCATGGTTGACTCGTCT
ATTGGAGGCAAGACCGCCATCGACACGCCCATGGGCAAGAATTTGGTTGGAGCCTTTTGGCAGCCGCGCCGCATT
TACATTGATCTGAAATTCTTAGATACGCTTCCTCCACGCGAATTTTTCAACGGTATGTCGGAGGTGATCAAAACG
GCCGCCATCTGGAACGAAGCCGAGTTTGCTTTCCTGGAGCAACAAGCCGCAGATATTGTAACGTGTGCTTCTTCA
ACTGCGAAAAACCGTCTCCAGCCGGTCAAAGAAGCCGTGAAGCGAATTGTCGTCAACGCGGCACGTGTCAAAGCC
GACGTTGTCACCAGAGATGAGCGAGAAGGCGGCTTGCGCAATCTCCTCAATTTTGGACACTCCATCGGCCACGCA
ATAGAGGCCATCCTGGCCCCCCAGATTCTTCACGGCGAAGCAGTTGCTATTGGGATGGTCAAGGAGGCAGAATTG
GCCCGCTTCGTTGGCGTTCTCCGTCCCCATGCCGTGGCCAGACTTTCTAAATGCATTGCGTCGTTTGGGCTCCCT
ACATCTTTGCATGACAAGCAGGTTGTCAAGTTAACTGCAGGCAAGCAGTGTCAAGTGGAAGAGATGCTGCGAAAG
ATGTCGGTTGACAAGAAGAACGACGGCGAACAGAAGAAAGTGGTGCTGTTATCTACCATCGGCAAGACTCATGAA
GACAAAGCCAGTGTGGTGGATGACAGTTCCATCAAACTGATCTTGAGTTCCTCCGTCCGAGTTACACCTGGCGTG
CCTCCAAATTGGCAGGTCACCGTCACTCCGCCCGGTTCCAAAAGCATCTCCAACCGGGCGTTGATCATGGCGGCT
CTCGGATCCGGCCGCTGCCGCTTGAAAAACCTGCTGCACTCTGACGACACAGAGTATATGCTATCCGCAATCACA
CGTCTTCGTGGCGCATCTTTCTCTTGGAAGGACGCTGGTGAGGTGCTCGAGGTTCATGGCAGAGCCGGCCAATTG
CAAGCTAGCAAGGACGACCTATACATTGGCAATGCCGGCACAGCATCTCGATTTCTCGCCACCGTCGTCGCCCTC
TGTCAACCTGCAGATGGTATCAAACACACGATTCTTACTGGCAATGATCGCATGAAGACCCGGCCGATAGGTCCC
CTTGTCGATGCGTTGCGATCGAACGGAGTCGATGTCGAGTATCTCGAGCTGGACAAAAGTCTTCCGCTTCGTGTC
CACGCTGCCGGTGGTTTCGACGGAGGACTCATCGAACTAGCTGCGACTGTGTCCTCCCAGTACGTCTCGTCTATA
CTGATGGCCGCGCCATTTGCCAAGAAGCCCGTTACTCTTCGCTTGGTCGGGGGCAAACCGGTCTCCCAACCCTAT
ATTGACATGACGATTTCCATGATGCTTTCGTTTGGGCTGGTAGTCACCAGGTCCGATTTGGAAACCAACACCTAC
CACATCCCCCAGGGTGTATACCGCAACCCCCTGGAGTACACGATTGAGAGTGACGCAAGCTCGGCCACCTACCCG
CTTGCTGTGGCTGCAATCACTGGGATGACCTGTATCGTCCCAAATATTGGATCTCAGTCTCTCCAAGGCGATGCA
CGGTTCGCCGTGGATATCTTGAGACCAATGGGCTGTCTCGTTGAACAGGACGAGGTTTCCACGAAAGTTACAGGG
CCGCCAGTTGGAACATTGCGGGGACTTCCGCACGTGGACATGGAGCCCATGACGGATGCCTTCCTAACAGCTTCG
GTACTGGCAGCAGTTGCACAAGGCAAGACGCAAATCACAGGCATCGCAAATCAGAGAGTCAAAGAATGCAATAGA
ATCAAGGCCATGGTGGATGAGCTTTCCAAATTTGGGGTCAAATGCTCGGAACTTGAAGATGGCATCGAGATATAT
GGCGATTCGCTGACAGGCATGCGGTCCGCAGATGCGACGATCCATTGCTACGACGATCATCGCGTCGCCATGAGC
TTCAGCGTCTTGGCCGTTGCTTCGCCAGGTGCTACCGTCATCACGCAACGCGAGTGTGTGGGGAAGACCTGGCCT
GGATGGTGGGATACGCTCAAGGAGTCTTTCGGTGTCACTTTGGCGGGCGTCGATGAAACCTCGGACCATCAGCGT
ACGCCTGGTGACGGCGACGCCGAACTCTCGATATTCGTCATCGGGATGAGAGGCGCAGGGAAGACAACGACTGGG
CAGTGGATGGCGTCTCTACTGGGCTGGGAATTCTTCGACTTGGACCAAGAACTTGAAAAGCGGTCGCGTAAATCT
ATCATTGAGATGGTCAGTGGATCAAGTCAATGGGAGGGTTTTCGCCAGGCAGAGCTGGAATTGTTACGCGACACA
ATGACAAGTCAACCCCAGCGTCATGTCTTCGCTTGTGGCGGGGGAGTTGTGGAAACTCCACAAGCAAGAGATCTG
TTGACGGCGCATTGCCGCCGAGGTGGTTACGTCGTCCTCGTTCACCGCAGCCTTGACCAGATTGTGGACTACTTA
AAGCAGGACGAGTCTCGACCGGCTTACGCAAGTGATGTTCGCGAAGTCTATCAGCGACGGAAGCTGTGGTACGAG
CAGTGCAGTAATTACGTTTATTTCAGCCCTCATTCAGGCAGTTCCGGCAGTGTTGAGGAAATACCTGATGACCTG
GAACTCTTTACGGTCTCCATGCGCGGAAGGAGCGGTCGGTCGGATGTCATGGCTGCCAAGGGAAAGCCCAGCTTC
TTCATTTCACTCACGCTGCCCAACCTCTTCAAGGGGCGAGAGTTGATCCCTCGCGTCGTTGACGGGGCTGATGCT
GTCGAGCTTCGCGTGGATCTCCTGGAAGATCAAAGCCCAGAAGCGGTCCTCGAGCAGGTATCTATCCTGCGTTCC
TCGGCCAGGAGGCCGATCATTTTCACTGTCCGCACCCAGTCCCAGGGGGGACAATTTCCCGACGACGCAGTTGGA
GAGCTCCAGACTCTTTATCGTTTAGCAATGCGGATGGCCGTAGAGTACCTTGACGTTGAGGTGACGGCCACTGAC
GAAACAATTCAAATAGTGACAGACCTGCGCGGACACACGCAGATCATTGCCTCGCATCACGATCCGCAAGGTAAC
TTAACCTGGAAGAATGCCTCGTGGATTCCTTTTTATAATAGGGCTTTGCAATTCGGAAACATCATCAAACTCGTC
GGCACTGCCCGGAATTTGGACGATAATTACCAACTGGCGAGCTTCAAGTCCAGAATGCTTGCCTCGCAGGAGATC
CCGATCATTGCGATTAATATGGGTTCTATGGGAAAGCTCAGCCGTATCTTGAACGGGTTCCTTACCCCCGTTACC
CATCCAGATCTGCCGTTCCCAGCTGCGCCAGGCCAATTGTCGGCCACCGAGATCCGTCAAGGCTTGACGCTGCTC
GGCCAAATCGACGCAAAAGTTTTTTATCTCTTTGGCAACCCGATCTCGCAGTCAAGATCGCCTACCATTCACAAC
CACCTCTTTCGACGGATGGGTCTGCCGCATTGTTACGAGCTGCGGGAGACCGACGATGTCGCTCAAGTGCAGCAG
GTGTTGCAGTCTTCAGCGTTCGGGGGAGCATCCGTCACCATACCCCTGAAGCGTCATGTCATGGCTCTGGTCGAC
GAACTAACACCGGCTGCCAAGATCATTGGCGCGATCAATACCATCATTCCGATTGCAAAGGCGAGGTCAAGCCAT
CGTCCTCACCTTCTCGGTGACAACACCGACTGGAAGGGCATTGTCCGGACGCTGAGGCAGAGCGGAGCATCGACG
CAGAAAAACGGGGCTTGCGCGATGGTGGTTGGATCTGGAGGGACGACGAGGGCTGCTGTTTATGCCCTCCGCTCG
ATGGGTTATTGTCCAATCTACGTCATAGCGCGGGATTCGAGTAAGGCTTTGGACCTGGCAGCCGGTTTCCCAAGC
GACTACAATATCGAAGTCATGGCCACCCATTCGGAGTTTGCGAACAAGAAAGCCTGCCCGAGCGTCATCATCAAC
ACCATTCCAGGTGACACACCGATAGACTCAAAGGTGAAGGAGGTCCTTGTCGGCACTTTCAATACTACAGAACAG
CAGGCTAATTGTCGGGTCCTGGTCGAAATGGCTTACAAGCCTCGCGTGACTCCCGTCATGGAGCTTGCTGGTGCT
GCCGGCGGATGGAGAGTGGTTCCGGGGCTCGAGCCGCTGGTATCCCAAGGATGCTACCAGGTATGTCCATGTCTG
GTACTGAGAAAACTTCGTTTTAAATGACGTATTATTTCTATTCGCAGTTTGAGCTTTGGACTGGCATAATACCTT
CACAAGACGCTGCGCGCGAAGCCTTGGGTCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail