Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04271
Gene name
Locationscaffold_04:2417456..2418078
Strand+
Gene length (bp)622
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03311 Cornichon Cornichon protein 7.3E-50 6 127

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 59 81 22
3 112 134 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 421.86 243.48 600.25
Alive In ants, during behavior modification 396.75 220.39 573.11
Dead In ants, recently dead 268.51 148.60 388.43

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.796208 no
Alive Dead 0.014273 yes
Dead Fungus 0.013747 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04271
MMSGEAWLYLLAVLINAVNLFLQVFFTIMYSDLECDYINPIELCNRLNAYVVPEAAVHAVLTFLFLVNGYWLALL
LNVPLLLWNAKKIIDNTHLLDATEIFRKLNVHKKESFAKLAFHLVMFFFYLYSMIVALIRDESS*
Coding >Ophcf2|04271
ATGATGTCGGGAGAGGCGTGGCTTTACCTTCTGGCCGTTTTAATCAACGCTGTGAATCTCTTTCTGCAGGTCTTT
TTCACCATCATGTACAGCGACCTAGAATGCGACTACATCAATCCTATCGAACTTTGCAACCGGTTAAATGCTTAC
GTCGTGCCCGAAGCAGCAGTACACGCTGTCCTAACATTCCTTTTCCTCGTAAATGGATACTGGCTGGCCCTCCTT
TTGAATGTGCCTCTTCTTCTTTGGAACGCGAAAAAGATTATAGACAACACCCACTTGCTAGATGCCACCGAAATC
TTTCGCAAGCTCAACGTACACAAAAAGGAATCTTTTGCCAAACTCGCTTTTCATTTAGTTATGTTCTTTTTCTAC
TTATATAGCATGATTGTAGCACTTATTAGAGATGAGTCTTCTTAA
Transcript >Ophcf2|04271
ATGATGTCGGGAGAGGCGTGGCTTTACCTTCTGGCCGTTTTAATCAACGCTGTGAATCTCTTTCTGCAGGTCTTT
TTCACCATCATGTACAGCGACCTAGAATGCGACTACATCAATCCTATCGAACTTTGCAACCGGTTAAATGCTTAC
GTCGTGCCCGAAGCAGCAGTACACGCTGTCCTAACATTCCTTTTCCTCGTAAATGGATACTGGCTGGCCCTCCTT
TTGAATGTGCCTCTTCTTCTTTGGAACGCGAAAAAGATTATAGACAACACCCACTTGCTAGATGCCACCGAAATC
TTTCGCAAGCTCAACGTACACAAAAAGGAATCTTTTGCCAAACTCGCTTTTCATTTAGTTATGTTCTTTTTCTAC
TTATATAGCATGATTGTAGCACTTATTAGAGATGAGTCTTCTTAA
Gene >Ophcf2|04271
ATGATGTCGGGAGAGGCGTGGCTTTACCTTCTGGCCGTTTTAATCAACGCTGTGAATCTCTTTCTGCAGGTCTTT
TTCACCATCATGTACAGCGACCTAGAATGGTATGTCAAATCAGGTCTTCATTTCAAGTTCTCTCTTGTGTCCTCC
GAGCTGCCATTTTTTGCAACGAAGACCATTCGATCCAGTCTAACGGCTAGTCACAGCGACTACATCAATCCTATC
GAACTTTGCAACCGGTTAAATGCTTACGTCGTGCCCGAAGCAGCAGTACACGCTGTCCTAACATTCCTTTTCCTC
GTAAATGGATACTGGCTGGCCCTCCTTTTGAATGTGCCTCTTCTTCTTTGGAACGCGAAAAAGTGAGAACATTGT
CGACCCCTTCTGAAGCAATGTTGCTAATAAATGATAAGGATTATAGACAACACCCACTTGCTAGATGCCACCGAA
ATCTTTCGCAAGCTCAACGTACACAAAAAGGTAACTGCTTCACCTATGCTGCATATGTCTCGCCTAGTAACAGTG
ACAGGAATCTTTTGCCAAACTCGCTTTTCATTTAGTTATGTTCTTTTTCTACTTATATAGCATGATTGTAGCACT
TATTAGAGATGAGTCTTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail