Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04271
Gene name
Locationscaffold_04:2417456..2418078
Strand+
Gene length (bp)622
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03311 Cornichon Cornichon protein 7.3E-50 6 127

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 59 81 22
3 112 134 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04271
MMSGEAWLYLLAVLINAVNLFLQVFFTIMYSDLECDYINPIELCNRLNAYVVPEAAVHAVLTFLFLVNGYWLALL
LNVPLLLWNAKKIIDNTHLLDATEIFRKLNVHKKESFAKLAFHLVMFFFYLYSMIVALIRDESS*
Coding >Ophcf2|04271
ATGATGTCGGGAGAGGCGTGGCTTTACCTTCTGGCCGTTTTAATCAACGCTGTGAATCTCTTTCTGCAGGTCTTT
TTCACCATCATGTACAGCGACCTAGAATGCGACTACATCAATCCTATCGAACTTTGCAACCGGTTAAATGCTTAC
GTCGTGCCCGAAGCAGCAGTACACGCTGTCCTAACATTCCTTTTCCTCGTAAATGGATACTGGCTGGCCCTCCTT
TTGAATGTGCCTCTTCTTCTTTGGAACGCGAAAAAGATTATAGACAACACCCACTTGCTAGATGCCACCGAAATC
TTTCGCAAGCTCAACGTACACAAAAAGGAATCTTTTGCCAAACTCGCTTTTCATTTAGTTATGTTCTTTTTCTAC
TTATATAGCATGATTGTAGCACTTATTAGAGATGAGTCTTCTTAA
Transcript >Ophcf2|04271
ATGATGTCGGGAGAGGCGTGGCTTTACCTTCTGGCCGTTTTAATCAACGCTGTGAATCTCTTTCTGCAGGTCTTT
TTCACCATCATGTACAGCGACCTAGAATGCGACTACATCAATCCTATCGAACTTTGCAACCGGTTAAATGCTTAC
GTCGTGCCCGAAGCAGCAGTACACGCTGTCCTAACATTCCTTTTCCTCGTAAATGGATACTGGCTGGCCCTCCTT
TTGAATGTGCCTCTTCTTCTTTGGAACGCGAAAAAGATTATAGACAACACCCACTTGCTAGATGCCACCGAAATC
TTTCGCAAGCTCAACGTACACAAAAAGGAATCTTTTGCCAAACTCGCTTTTCATTTAGTTATGTTCTTTTTCTAC
TTATATAGCATGATTGTAGCACTTATTAGAGATGAGTCTTCTTAA
Gene >Ophcf2|04271
ATGATGTCGGGAGAGGCGTGGCTTTACCTTCTGGCCGTTTTAATCAACGCTGTGAATCTCTTTCTGCAGGTCTTT
TTCACCATCATGTACAGCGACCTAGAATGGTATGTCAAATCAGGTCTTCATTTCAAGTTCTCTCTTGTGTCCTCC
GAGCTGCCATTTTTTGCAACGAAGACCATTCGATCCAGTCTAACGGCTAGTCACAGCGACTACATCAATCCTATC
GAACTTTGCAACCGGTTAAATGCTTACGTCGTGCCCGAAGCAGCAGTACACGCTGTCCTAACATTCCTTTTCCTC
GTAAATGGATACTGGCTGGCCCTCCTTTTGAATGTGCCTCTTCTTCTTTGGAACGCGAAAAAGTGAGAACATTGT
CGACCCCTTCTGAAGCAATGTTGCTAATAAATGATAAGGATTATAGACAACACCCACTTGCTAGATGCCACCGAA
ATCTTTCGCAAGCTCAACGTACACAAAAAGGTAACTGCTTCACCTATGCTGCATATGTCTCGCCTAGTAACAGTG
ACAGGAATCTTTTGCCAAACTCGCTTTTCATTTAGTTATGTTCTTTTTCTACTTATATAGCATGATTGTAGCACT
TATTAGAGATGAGTCTTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail