Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04266
Gene name
Locationscaffold_04:2215078..2215650
Strand+
Gene length (bp)572
Transcript length (bp)522
Coding sequence length (bp)522
Protein length (aa) 174

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00125 Histone Core histone H2A/H2B/H3/H4 1.0E-09 1 46
PF00808 CBFD_NFYB_HMF Histone-like transcription factor (CBF/NF-Y) and archaeal histone 1.7E-06 2 46

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4086 0.8343 0.0484 0.0549 0.0232 0.003 0.1178 0.1532 0.0959 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Histone-like TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5125
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1033
Ophiocordyceps australis map64 (Brazil) OphauB2|5024
Ophiocordyceps camponoti-floridani Ophcf2|04266 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|343
Ophiocordyceps kimflemingae Ophio5|8494
Ophiocordyceps subramaniannii Hirsu2|3405

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04266
MISAEAPILFAKGCDIFITELTMRAWIHAEENKRRTLQRSDIASALAKSDMFDFLIDIVPREEASSHAKRTAAHP
STAAASGQGPIPNQHNTMGQNHTSHSMGPSDYMAGHHLAAEQEYRQNANMYPSQVPQAASATYGQPQASASMYGE
MEGMYSYSTMQPQQATMSPEEFD*
Coding >Ophcf2|04266
ATGATTTCCGCCGAAGCTCCGATACTCTTCGCAAAAGGCTGCGATATCTTCATCACCGAGCTAACTATGAGAGCT
TGGATTCACGCCGAGGAGAACAAACGTCGCACCTTGCAGCGTTCGGACATCGCCTCGGCCCTTGCCAAGTCTGAT
ATGTTTGACTTTCTCATTGACATAGTGCCTCGGGAAGAGGCTTCGTCCCACGCCAAAAGGACTGCTGCACACCCT
TCTACCGCCGCAGCTTCCGGTCAAGGCCCAATACCTAATCAGCACAATACCATGGGTCAAAACCACACCTCGCAC
TCTATGGGTCCTTCAGATTACATGGCCGGGCATCATCTCGCTGCAGAGCAAGAATATCGTCAGAATGCCAACATG
TATCCAAGCCAAGTTCCCCAGGCTGCCTCAGCTACATACGGTCAGCCCCAGGCATCGGCTTCAATGTACGGAGAG
ATGGAGGGCATGTATTCATACTCGACAATGCAGCCTCAGCAGGCAACTATGTCACCGGAAGAATTTGATTAA
Transcript >Ophcf2|04266
ATGATTTCCGCCGAAGCTCCGATACTCTTCGCAAAAGGCTGCGATATCTTCATCACCGAGCTAACTATGAGAGCT
TGGATTCACGCCGAGGAGAACAAACGTCGCACCTTGCAGCGTTCGGACATCGCCTCGGCCCTTGCCAAGTCTGAT
ATGTTTGACTTTCTCATTGACATAGTGCCTCGGGAAGAGGCTTCGTCCCACGCCAAAAGGACTGCTGCACACCCT
TCTACCGCCGCAGCTTCCGGTCAAGGCCCAATACCTAATCAGCACAATACCATGGGTCAAAACCACACCTCGCAC
TCTATGGGTCCTTCAGATTACATGGCCGGGCATCATCTCGCTGCAGAGCAAGAATATCGTCAGAATGCCAACATG
TATCCAAGCCAAGTTCCCCAGGCTGCCTCAGCTACATACGGTCAGCCCCAGGCATCGGCTTCAATGTACGGAGAG
ATGGAGGGCATGTATTCATACTCGACAATGCAGCCTCAGCAGGCAACTATGTCACCGGAAGAATTTGATTAA
Gene >Ophcf2|04266
ATGATTTCCGCCGAAGCTCCGATACTCTTCGCAAAAGGCTGCGATATCTTCATCACCGAGCTAACTATGAGAGCT
TGGATTCACGCCGAGGAGAACAAACGTCGCACCTTGCAGCGTTCGGACATCGCCTCGGCCCTTGCCAAGTCTGAT
ATGTTTGACTTTCTCATTGACATAGTGCCTCGGGAAGAGGCTTCGTCCCACGCCAAAAGGACTGCTGCACACCCT
TCTACCGCCGCAGCTTCCGGTCAAGGCCCAATACCTAATCAGCACAATACCATGGGTCAAAACCACACCTCGCAC
TCTATGGGTCCTTCAGATTACATGGCCGGGCATCATCTCGCTGCAGAGCAAGAATATCGTCAGAATGCCAACATG
TATCCAAGCCAAGTTCCCCAGGCTGCCTCAGCTACATACGGTCAGCCCCAGGCATCGGCTTCAATGTACGGAGAG
ATGGAGGGCATGTATTCATACTCGACAATGCAGCCTCAGCAGGTCAGTTCAAATTCTCTACCTTGCGCACATGCG
TTCTCACTTTAGGCCAGGCAACTATGTCACCGGAAGAATTTGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail