Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04264
Gene name
Locationscaffold_04:2168053..2169025
Strand+
Gene length (bp)972
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04433 SWIRM SWIRM domain 1.4E-31 134 219

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear export signal 0.439 0.7432 0.0134 0.0366 0.1653 0.0867 0.0451 0.057 0.1857 0.0685

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5307
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7674
Ophiocordyceps australis map64 (Brazil) OphauB2|5547
Ophiocordyceps camponoti-floridani Ophcf2|04264 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5249
Ophiocordyceps kimflemingae Ophio5|399
Ophiocordyceps subramaniannii Hirsu2|4855

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04264
MDVEDNASYGSPNNGESPNGNPILAQPPLQPDASGLDEQDVMMVGGRSNTVDVKQSDTHSQPTPDDQLEMIEGNS
DEAALRDDEDMGDVSVDIKETVALVQDSSHEDQDIKSKDATESTARDHLLSQTHAIVLPSYSTWFDMNNIHDIER
KAMAEFFNSRNRSKTPVVYKDYRDFMINTYRLNPAEYLTVTACRRNLAGDVCAIMRVHAFVEQWGLINYQVDAEQ
RPSHVGPPFTGHFKIICDTPRGLQAWQPSADPV*
Coding >Ophcf2|04264
ATGGACGTTGAAGACAATGCAAGTTACGGATCTCCAAATAATGGCGAGTCACCAAATGGGAATCCGATTTTGGCG
CAACCACCGCTACAGCCTGATGCGAGCGGTCTCGATGAGCAAGATGTGATGATGGTAGGAGGTCGATCCAATACT
GTAGATGTGAAGCAGAGCGACACACACTCTCAACCAACTCCCGATGATCAGCTTGAGATGATAGAGGGGAACTCA
GATGAGGCTGCTCTTCGTGACGACGAGGATATGGGCGATGTGTCAGTGGACATTAAAGAGACTGTCGCTTTAGTC
CAAGATTCCTCCCACGAGGATCAGGACATAAAGTCGAAAGACGCCACTGAGTCTACAGCTCGTGATCATCTTCTG
TCGCAGACGCACGCCATCGTTCTCCCCAGCTATAGCACATGGTTCGACATGAATAACATTCACGATATCGAGCGC
AAGGCCATGGCGGAATTCTTCAATAGTCGTAACAGGAGTAAAACACCTGTCGTCTACAAAGATTATCGCGATTTT
ATGATCAACACTTACAGGCTCAATCCAGCCGAGTATCTAACTGTGACGGCTTGCCGACGAAACCTGGCCGGTGAT
GTGTGCGCAATTATGCGGGTGCACGCCTTTGTTGAACAATGGGGCTTGATAAATTACCAGGTGGACGCCGAGCAA
AGACCCTCCCACGTGGGCCCGCCCTTCACCGGTCATTTCAAGATCATATGCGACACTCCGCGGGGTCTGCAAGCT
TGGCAACCTTCAGCTGACCCAGTGTAG
Transcript >Ophcf2|04264
ATGGACGTTGAAGACAATGCAAGTTACGGATCTCCAAATAATGGCGAGTCACCAAATGGGAATCCGATTTTGGCG
CAACCACCGCTACAGCCTGATGCGAGCGGTCTCGATGAGCAAGATGTGATGATGGTAGGAGGTCGATCCAATACT
GTAGATGTGAAGCAGAGCGACACACACTCTCAACCAACTCCCGATGATCAGCTTGAGATGATAGAGGGGAACTCA
GATGAGGCTGCTCTTCGTGACGACGAGGATATGGGCGATGTGTCAGTGGACATTAAAGAGACTGTCGCTTTAGTC
CAAGATTCCTCCCACGAGGATCAGGACATAAAGTCGAAAGACGCCACTGAGTCTACAGCTCGTGATCATCTTCTG
TCGCAGACGCACGCCATCGTTCTCCCCAGCTATAGCACATGGTTCGACATGAATAACATTCACGATATCGAGCGC
AAGGCCATGGCGGAATTCTTCAATAGTCGTAACAGGAGTAAAACACCTGTCGTCTACAAAGATTATCGCGATTTT
ATGATCAACACTTACAGGCTCAATCCAGCCGAGTATCTAACTGTGACGGCTTGCCGACGAAACCTGGCCGGTGAT
GTGTGCGCAATTATGCGGGTGCACGCCTTTGTTGAACAATGGGGCTTGATAAATTACCAGGTGGACGCCGAGCAA
AGACCCTCCCACGTGGGCCCGCCCTTCACCGGTCATTTCAAGATCATATGCGACACTCCGCGGGGTCTGCAAGCT
TGGCAACCTTCAGCTGACCCAGTGTAG
Gene >Ophcf2|04264
ATGGACGTTGAAGACAATGCAAGTTACGGATCTCCAAATAATGGCGAGTCACCAAATGGGAATCCGATTTTGGCG
CAACCACCGCTACAGCCTGATGCGAGCGGTCTCGATGAGCAAGGTCCGTCTGGCGCTTTTGGCCGGAAACGAAGC
TAACTTTGTTACTGGAGATTTAGATGTGATGATGGTAGGAGGTCGATCCAATACTGTAGATGTGAAGCAGAGCGA
CACACACTCTCAACCAACTCCCGATGATCAGCTTGAGATGATAGAGGGGAACTCAGATGAGGCTGCTCTTCGTGA
CGACGAGGATATGGGCGATGTGTCAGTGGACATTAAAGAGACTGTCGCTTTAGTCCAAGATTCCTCCCACGAGGA
TCAGGACATAAAGTCGAAAGACGCCACTGAGTCTACAGCTCGTGATCATCTTCTGTCGCAGACGCACGCCATCGT
TCTCCCCAGCTATAGCACATGGTTCGACATGAATAACATTCACGATATCGAGCGCAAGGCCATGGCGGAATTCTT
CAATAGTCGTAACAGGAGTAAAACACCTGTCGTCTACAAAGATTATCGCGATTTTATGATCAACACTTACAGGCT
CAATCCAGCCGAGTATCTAACTGTGACGGCTTGCCGACGAAACCTGGCCGGTGATGTGTGCGCAATTATGCGGGT
GCACGCCTTTGTTGAACAATGGGGCTTGATAAATTACCAGGTAAGGTCTTCTCCTAGCGGCCTCCTGCGAATCCA
GTCTCAGCTTTGCGGAATAGCATGCCTGGAGGCTGACTGTGTCCAGGTGGACGCCGAGCAAAGACCCTCCCACGT
GGGCCCGCCCTTCACCGGTCATTTCAAGATCATATGCGACACTCCGCGGGGTCTGCAAGCTTGGCAACCTTCAGC
TGACCCAGTGGTACTGGAAGGGAAACGGAACCACGACACTGACAAGAAGGGAATGGCGTCCACCTGCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail