Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|04261
Gene name
Locationscaffold_04:1907403..1908335
Strand+
Gene length (bp)932
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase 7.1E-62 7 261

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6058 0.4127 0.1719 0.0471 0.4944 0.0678 0.12 0.0659 0.0673 0.0023

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5438
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6107
Ophiocordyceps australis map64 (Brazil) OphauB2|4593
Ophiocordyceps camponoti-floridani Ophcf2|04261 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6565
Ophiocordyceps kimflemingae Ophio5|1289
Ophiocordyceps subramaniannii Hirsu2|5983

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|04261
MALRTLKIGLIPGDGIGKEIIPTGRRILEALPNSAKLKFEFINLKAGFEVFEETGTALPETTLQALRDYCHGALF
GAVSSPTRAVRGYSSPIVDLRKRLDLYANIRPVKNVHTEPKAIDMVIVRENTEDLYIKEERTFDGPQGKIAEATK
RISELACFRIGSIAGEIAMRRHENRLRRALIKAKAPRVTITHKSNVLTQTDGLFRQIVEQTLNDEKFATVEIEEQ
IVDSMVYKLFRQPQNYDVIVAPNLYGDILSDGAAALCS*
Coding >Ophcf2|04261
ATGGCACTTCGCACACTTAAGATAGGCCTGATCCCCGGAGATGGCATCGGAAAGGAAATAATACCCACAGGGCGT
CGCATCTTAGAAGCGTTGCCAAACTCGGCCAAGCTCAAATTTGAGTTTATCAATCTCAAAGCTGGATTTGAGGTT
TTTGAAGAGACGGGCACCGCCTTACCTGAGACTACGTTACAAGCTCTACGCGATTATTGCCATGGGGCTCTGTTC
GGCGCTGTCAGCTCACCAACACGCGCTGTCAGAGGATACTCATCCCCTATTGTGGATCTTCGAAAAAGGCTCGAC
CTTTATGCAAATATTCGCCCTGTTAAAAATGTTCACACGGAGCCTAAGGCTATTGATATGGTCATTGTTCGAGAG
AACACCGAAGATCTATACATAAAGGAGGAAAGGACTTTTGATGGCCCCCAAGGCAAGATAGCTGAGGCCACAAAG
CGTATTTCCGAGTTGGCCTGCTTTCGAATTGGAAGCATAGCCGGCGAGATTGCCATGCGTCGCCATGAAAATCGC
CTCCGTCGTGCGTTGATTAAAGCCAAGGCGCCACGAGTCACCATCACCCACAAATCAAATGTCCTCACTCAGACA
GATGGCCTCTTCCGGCAAATCGTTGAACAAACTCTCAACGATGAGAAATTCGCTACAGTCGAGATCGAGGAGCAG
ATAGTTGATTCTATGGTCTACAAGCTGTTTCGACAACCTCAAAATTACGATGTTATTGTTGCACCGAACCTTTAC
GGTGATATCCTATCCGATGGGGCTGCTGCTCTGTGCTCCTGA
Transcript >Ophcf2|04261
ATGGCACTTCGCACACTTAAGATAGGCCTGATCCCCGGAGATGGCATCGGAAAGGAAATAATACCCACAGGGCGT
CGCATCTTAGAAGCGTTGCCAAACTCGGCCAAGCTCAAATTTGAGTTTATCAATCTCAAAGCTGGATTTGAGGTT
TTTGAAGAGACGGGCACCGCCTTACCTGAGACTACGTTACAAGCTCTACGCGATTATTGCCATGGGGCTCTGTTC
GGCGCTGTCAGCTCACCAACACGCGCTGTCAGAGGATACTCATCCCCTATTGTGGATCTTCGAAAAAGGCTCGAC
CTTTATGCAAATATTCGCCCTGTTAAAAATGTTCACACGGAGCCTAAGGCTATTGATATGGTCATTGTTCGAGAG
AACACCGAAGATCTATACATAAAGGAGGAAAGGACTTTTGATGGCCCCCAAGGCAAGATAGCTGAGGCCACAAAG
CGTATTTCCGAGTTGGCCTGCTTTCGAATTGGAAGCATAGCCGGCGAGATTGCCATGCGTCGCCATGAAAATCGC
CTCCGTCGTGCGTTGATTAAAGCCAAGGCGCCACGAGTCACCATCACCCACAAATCAAATGTCCTCACTCAGACA
GATGGCCTCTTCCGGCAAATCGTTGAACAAACTCTCAACGATGAGAAATTCGCTACAGTCGAGATCGAGGAGCAG
ATAGTTGATTCTATGGTCTACAAGCTGTTTCGACAACCTCAAAATTACGATGTTATTGTTGCACCGAACCTTTAC
GGTGATATCCTATCCGATGGGGCTGCTGCTCTGTGCTCCTGA
Gene >Ophcf2|04261
ATGGCACTTCGCACACTTAAGATAGGTTAGTGTTGCTAGTCTCCGATTAATACACTTTAAAATGCTAGGATTGCT
GACTCTCGATGAGTAGGCCTGATCCCCGGAGATGGCATCGGAAAGGAAATAATACCCACAGGGCGTCGCATCTTA
GAAGCGTTGCCAAACTCGGCCAAGCTCAAATTTGAGTTTATCAATCTCAAAGCTGGATTTGAGGTTTTTGAAGAG
ACGGGCACCGCCTTACCTGAGACTACGTTACAAGCTCTACGCGATTATTGCCATGGGGCTCTGTTCGGCGCTGTC
AGCTCACCAACACGCGCTGTCAGAGGATACTCATCCCCTATTGTGGATCTTCGAAAAAGGCTCGACCTTTATGCA
AATATTCGCCCTGTTAAAAATGTTCACACGGAGCCTAAGGCTATTGATATGGTCATTGTTCGAGAGAACACCGAA
GATCTATACATAAAGGAGGAAAGGACTTTTGATGGCCCCCAAGGCAAGATAGCTGAGGCCACAAAGCGTATTTCC
GAGTTGGCCTGCTTTCGAATTGGAAGCATAGCCGGCGAGATTGCCATGCGTCGCCATGAAAATCGCCTCCGTCGT
GCGTTGATTAAAGCCAAGGCGCCACGAGTCACCATCACCCACAAATCAAATGTCCTCACTCAGACAGATGGCCTC
TTCCGGCAAATCGTTGAACAAACTCTCAACGATGAGAAATTCGCTACAGTCGAGATCGAGGAGCAGATAGTTGAT
TCTATGGTCTACAAGCTGTTTCGACAACCTCAAAATTACGATGTTATTGTTGCACCGAACCTTTACGGTGATATC
CTATCCGATGGGGCTGCTGCTCTGGTTGGTAGCTTGGGGCTTGTCCCTAGCGCTAATGTCGGAGATAACTTCGTC
ATAGGCGAGCCATGTCATGGTAGTGCTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail